KEGG   Corynebacterium urealyticum DSM 7109: cur_0789Help
Entry
cur_0789          CDS       T00685                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cur03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942740..943609
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEVVRRGLEEHLSDGVIHDVDVRHPRAVRAQPGGAAELVALLDGARIQSIERRG
KYMWLVLNNGRALFVHLGMSGQMLIHEASDPALPTTHVRISARVDVGEKDLVLSFVDQRT
FGQWQVTPVVADPHGGFTGVPVPVAHIAPDPFEAVFDPAVVARRLRAKKTDVKRAILDQT
LVSGIGNIYADEALWAAGVAPSRRTRGMRQRDAVAVLEQAGAVMRRALAQGGTSFDSLYV
NVNGASGYFARSLNAYGRAGKPCPRCGEPIVRVQWTNRSSHFCPQCQSS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctgcctgaggtggaggtcgtccgtcgcgggctggaagaacatctcagcgat
ggggtcatccacgacgtcgacgtccgtcatccccgcgccgttcgcgcccagcctggcggg
gctgcggagctcgtcgcgcttctggacggtgcccgcatccagtccattgagcgccgggga
aagtacatgtggctcgtgctgaataatggccgtgcgctgttcgtccacctcgggatgagc
gggcagatgctgatccatgaggcttcggatccggctctgcccaccacgcacgtccgaatt
tctgcgcgggtcgacgtgggggagaaggacctggtgctgagtttcgtggatcagcgcacc
tttggtcagtggcaggtcacgcccgtcgtggcagacccgcacgggggctttacgggggtg
ccggttccggttgcgcacatcgcccccgatcccttcgaggcggtcttcgacccggcggtc
gtggcccggcgcctcagggcgaagaagaccgatgtgaagcgtgcgatcctggatcaaaca
ctggtctcggggattggaaatatttacgccgacgaggcgctgtgggccgcgggcgtagct
cccagccgccgtacccggggcatgcgccaacgcgacgccgtggccgtattggagcaggcc
ggggcggtgatgcgccgggcgctggcccagggcggcaccagttttgattcgctctacgtc
aacgtcaacggagccagcggctacttcgcccgctcgctcaatgcctacggcagggccggg
aagccatgcccccgctgtggggagccgatcgttcgggtgcagtggacgaaccgatcctca
cacttctgcccgcagtgccagtccagctag

DBGET integrated database retrieval system