KEGG   Corynebacterium urealyticum DSM 7109: cur_0902Help
Entry
cur_0902          CDS       T00685                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0902
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cur_0902
   00520 Amino sugar and nucleotide sugar metabolism
    cur_0902
Enzymes [BR:cur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     cur_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080190..1081095)
Genome map
AA seq 301 aa AA seqDB search
MSTEQANSAEWAGITVGVDVGGSAIKAGFVDTRNHCLVGERFTAPTPQPATPEAVAGAVA
TLATQVLAQELGTGLPGASSLSRVQNLRIGVAIPSVVANQQARTAANIAHSWIGTRPAAV
FDDALRKALSYGPSDRSALQVEWFFLNDADAAGISECGPCAAGEAADPEYSRLFLTFGTG
IGSALFRGSRLYPNTELGHLTVLTDDGSPSAAEHWASAAVKARQHLSFPEWAARVSTVLN
TYVALLRPQELILGGGISAESDRWLPKLELEEPSVRVSIARHFNSAGVIGAGLAASWGLR
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagcaggcgaatagcgctgaatgggcgggcatcaccgtgggcgtcgacgtc
ggaggctccgcaatcaaggcgggcttcgtcgacacccgcaaccactgtctcgttggggaa
agattcaccgcccccactccccaaccagcaaccccagaagccgtcgcgggtgccgtcgcg
accctcgcaacacaggtactcgcccaagaacttggcacgggcctccccggggcatcttcc
ctcagcagggttcagaacctccggatcggcgtagccattcccagcgtggtagccaaccag
caggcacgcaccgcagcgaatatcgcgcattcctggatcggtacccgacccgccgcggtg
ttcgacgacgccctgaggaaggcgttgtcgtacggcccgtcggatcgttccgccctccag
gtagagtggttcttcctcaacgacgccgacgctgccggcatttctgaatgcggcccgtgc
gccgccggcgaggctgctgacccggaatacagtcggctcttcctgacctttggcacaggg
atcggctctgctctcttccgcggaagcaggttgtaccccaataccgagctggggcaccta
accgtgttgacggacgacggctcccccagcgctgcagagcattgggcctcggcggcggtg
aaggctcggcagcacctttctttccccgagtgggcagcccgggtgagcacggtgctcaac
acctatgtcgcgttgctgcggccccaggagctgatcctcggcggcgggatctccgccgaa
tcagaccggtggttgcccaagcttgagctcgaagagccttcggtccgtgtgagcatcgcg
cgacacttcaacagcgcgggcgtcattggggcgggactcgccgcttcttgggggctacgc
ccctaa

DBGET integrated database retrieval system