KEGG   Corynebacterium urealyticum DSM 7109: cur_0916Help
Entry
cur_0916          CDS       T00685                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cur_0916
Enzymes [BR:cur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     cur_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094222..1095625
Genome map
AA seq 467 aa AA seqDB search
MTTARKPRIAVIGGGIAGVSAAWQLRQQLGDRAQLMLAEAYGRLGGKLKTVRFSTGPVDM
GAEAFLSFDQQFMELIDKLGMSSELRTPSTARSSFLVDGTFVDIPRETLMGIPVSADVAS
EVLSPAEAARLDAERDGQPMTWNAGDDTTVGALVEARLGKAVVDKLVSPLLGGVYSCSAY
DLGVRATLPQLAEALDRAGEGGQAFFLLDVVEELLAKRRATAVGGGGSPFRSFDKGYRSL
IEEMMRQADPELILNSAVEELGRTSDGRWVIDPLGTVDAVVVATSAPTASVILQDAAPAA
AEALGSVELSSSAVVGMRFASDHGIPERSGVLLGSNSGTAAKAFTFSSKKWPHLAQGGGA
FVRASFGTKDEPWYVDASDRALLAYALEDLERVTGERKTPEEIFVQRWHGGIPCYGVHHS
EKMSRVLEDVAGVPRLAVAGSMLRGVGVPATVASGVAAADKIIADLG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggcgcgaaagccacgcattgccgtcatcggtggcgggatcgccggagtcagc
gcggcctggcagctccgccaacagctgggggatcgcgcccagctgatgcttgctgaggct
tatgggcgcctgggcgggaagttgaagacggtgcgtttttccaccggccccgtggatatg
ggcgcggaggcattcttgagcttcgaccagcagttcatggagctgatcgacaagctggga
atgagttccgagttacgcaccccctctacggcacgctcctccttcctggtggatggcaca
ttcgttgacatcccgcgggagaccctgatgggcattccagtctctgccgacgtggcatcc
gaggtgctcagccccgcggaggcagcccggctcgacgccgagcgggacggccagccgatg
acgtggaacgcgggtgatgacaccaccgttggcgctctggttgaggcccggttgggcaag
gccgtggtggataagctggtctcgccgctactgggtggggtgtattcctgtagcgcctat
gacctcggcgtgcgtgccaccctgccacagctggcggaggcattggatcgtgcaggtgag
ggaggtcaggctttcttcctgctcgacgtcgtggaggagttgctcgcgaagcgccgggcc
acggcggttggtggtgggggatcgccattccgttccttcgacaagggctaccgcagcctg
atcgaagagatgatgcgccaagctgaccctgaactgatcctgaactccgctgtcgaggag
ctcggcaggacgtcggatggccggtgggtcatcgacccactggggacggtggacgccgtc
gtcgtcgcgacctctgcgccaaccgcgtcggtcatcttgcaggacgctgcgcctgcggcc
gcggaggcgttgggcagcgtagaactctcgagctcggcggtggtggggatgcgtttcgcc
tccgaccacggtatcccggagcgctccggcgtgttgctgggctctaactcaggcaccgca
gcgaaggccttcaccttcagctcgaagaagtggccgcatctcgcccagggcggtggagcc
ttcgtccgcgcctccttcggaaccaaggacgaaccctggtacgtcgacgcgagtgacagg
gctctgttggcttatgctctggaggatctggagcgggtcacaggcgagcggaaaactccg
gaggaaatcttcgtgcagcgctggcacggtgggatcccgtgttacggggttcaccattcc
gaaaagatgtcccgggtcttggaggacgttgccggggttcctcgtctcgcggtggctggt
tcgatgctacgcggggttggggtgccggctaccgttgcgtccggggtcgctgcggcagat
aagattatcgccgacttgggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system