KEGG   Corynebacterium urealyticum DSM 7109: cur_0916Help
Entry
cur_0916          CDS       T00685                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cur00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094222..1095625
Genome map
AA seq 467 aa AA seqDB search
MTTARKPRIAVIGGGIAGVSAAWQLRQQLGDRAQLMLAEAYGRLGGKLKTVRFSTGPVDM
GAEAFLSFDQQFMELIDKLGMSSELRTPSTARSSFLVDGTFVDIPRETLMGIPVSADVAS
EVLSPAEAARLDAERDGQPMTWNAGDDTTVGALVEARLGKAVVDKLVSPLLGGVYSCSAY
DLGVRATLPQLAEALDRAGEGGQAFFLLDVVEELLAKRRATAVGGGGSPFRSFDKGYRSL
IEEMMRQADPELILNSAVEELGRTSDGRWVIDPLGTVDAVVVATSAPTASVILQDAAPAA
AEALGSVELSSSAVVGMRFASDHGIPERSGVLLGSNSGTAAKAFTFSSKKWPHLAQGGGA
FVRASFGTKDEPWYVDASDRALLAYALEDLERVTGERKTPEEIFVQRWHGGIPCYGVHHS
EKMSRVLEDVAGVPRLAVAGSMLRGVGVPATVASGVAAADKIIADLG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggcgcgaaagccacgcattgccgtcatcggtggcgggatcgccggagtcagc
gcggcctggcagctccgccaacagctgggggatcgcgcccagctgatgcttgctgaggct
tatgggcgcctgggcgggaagttgaagacggtgcgtttttccaccggccccgtggatatg
ggcgcggaggcattcttgagcttcgaccagcagttcatggagctgatcgacaagctggga
atgagttccgagttacgcaccccctctacggcacgctcctccttcctggtggatggcaca
ttcgttgacatcccgcgggagaccctgatgggcattccagtctctgccgacgtggcatcc
gaggtgctcagccccgcggaggcagcccggctcgacgccgagcgggacggccagccgatg
acgtggaacgcgggtgatgacaccaccgttggcgctctggttgaggcccggttgggcaag
gccgtggtggataagctggtctcgccgctactgggtggggtgtattcctgtagcgcctat
gacctcggcgtgcgtgccaccctgccacagctggcggaggcattggatcgtgcaggtgag
ggaggtcaggctttcttcctgctcgacgtcgtggaggagttgctcgcgaagcgccgggcc
acggcggttggtggtgggggatcgccattccgttccttcgacaagggctaccgcagcctg
atcgaagagatgatgcgccaagctgaccctgaactgatcctgaactccgctgtcgaggag
ctcggcaggacgtcggatggccggtgggtcatcgacccactggggacggtggacgccgtc
gtcgtcgcgacctctgcgccaaccgcgtcggtcatcttgcaggacgctgcgcctgcggcc
gcggaggcgttgggcagcgtagaactctcgagctcggcggtggtggggatgcgtttcgcc
tccgaccacggtatcccggagcgctccggcgtgttgctgggctctaactcaggcaccgca
gcgaaggccttcaccttcagctcgaagaagtggccgcatctcgcccagggcggtggagcc
ttcgtccgcgcctccttcggaaccaaggacgaaccctggtacgtcgacgcgagtgacagg
gctctgttggcttatgctctggaggatctggagcgggtcacaggcgagcggaaaactccg
gaggaaatcttcgtgcagcgctggcacggtgggatcccgtgttacggggttcaccattcc
gaaaagatgtcccgggtcttggaggacgttgccggggttcctcgtctcgcggtggctggt
tcgatgctacgcggggttggggtgccggctaccgttgcgtccggggtcgctgcggcagat
aagattatcgccgacttgggctaa

DBGET integrated database retrieval system