KEGG   Corynebacterium urealyticum DSM 7109: cur_0935Help
Entry
cur_0935          CDS       T00685                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cur03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1113294..1113914
Genome map
AA seq 206 aa AA seqDB search
MISSLRGDVIDKGLDYVVIECGGVGYRCLATGDTLATLRRGESAFVLTSLVIRDDAHTLY
AFSTSEQRETFGILQKVSGVGARLAMGVMSVLQPADIARAVEEGDIKTLQQAPGVGKRLA
ERMAVDLKGKFPALEATSGQATIGDIAATGNDTALQSQVVEALVGLGFTEAKAATAVKKI
LEEQNGTTDPSSVLREALQRLSGQKR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctcgctgcgcggtgacgtaatcgataagggcttggactacgttgtgatcgaa
tgcggcggggtgggataccgctgcctcgcgaccggcgataccctcgccacattgcggcgc
ggcgagtcggctttcgtcctcaccagcctcgtgatccgggacgatgcgcatacgctctac
gctttttccacctccgaacagcgcgagaccttcgggatcttgcagaaggtctccggtgtg
ggcgcccgcctcgccatgggcgtgatgagtgtgctgcagccggcggacattgctcgggct
gtcgaggagggggatatcaagaccttgcagcaagccccgggggtggggaagcggctagcc
gaacgcatggctgtcgacctcaagggcaagtttccggctctggaagcgacgagcggccag
gcgaccattggcgacatcgcggcgaccggcaacgacacggcgttgcagtcgcaggtcgtg
gaggcgcttgtcggcctcggcttcactgaagccaaggcagccacggctgtgaagaagatt
ctcgaggagcagaacggaaccaccgacccatcctcggtgctgcgtgaggcgctacaacgg
ctgagcggccaaaagcgttaa

DBGET integrated database retrieval system