KEGG   Corynebacterium urealyticum DSM 7109: cur_0993Help
Entry
cur_0993          CDS       T00685                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0993 (tpiA)
   01230 Biosynthesis of amino acids
    cur_0993 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cur_0993 (tpiA)
   00051 Fructose and mannose metabolism
    cur_0993 (tpiA)
   00562 Inositol phosphate metabolism
    cur_0993 (tpiA)
Enzymes [BR:cur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cur_0993 (tpiA)
Exosome [BR:cur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cur_0993 (tpiA)
  Exosomal proteins of bladder cancer cells
   cur_0993 (tpiA)
  Exosomal proteins of melanoma cells
   cur_0993 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178239..1179030
Genome map
AA seq 263 aa AA seqDB search
MAAHSAVKRKPLIAGNWKMNLNHLEAIQVVQKFSFALPKEYYERVDVAILPPFTDIRSVQ
TIVEGDKLQISYGAQDVSAHDSGAYTGEVSGAMLAKLGCSFAVVGHSERRQYHGEDDATV
AAKARAALKHSLTPIVCVGEPLEVREAGEHVGYVVDQLQASLSGLGGEELSKIVLAYEPV
WAIGTGKVASAADAQEVCAAVREALAELGGEDVAAGVRVLYGGSVKRESIGELMAQPDID
GGLVGGASLDGAEFARLVAASVS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtggcagctcacagcgccgtcaagcgcaagcccctgatcgcgggcaattggaagatgaac
ctcaaccaccttgaggcgatccaggtggtgcagaagttttccttcgctctgccgaaggag
tactacgagcgagtcgacgtcgcgattctgccaccgttcaccgacatccgctccgtgcag
acgatcgtcgagggtgacaagctgcagatcagctatggcgcccaggacgtctctgcccac
gactccggtgcgtacaccggtgaggtctccggtgcgatgctcgcgaagctgggttgcagc
ttcgcggttgtcggtcactctgagcgccgtcagtaccacggtgaggacgatgcgacggtc
gctgcgaaggcgcgtgccgcgctcaagcatagtctgaccccgatcgtctgcgtcggcgag
ccgctggaggttcgtgaggcgggcgagcacgtgggctacgtcgtcgaccagctccaggcg
tcgctttccggcctcggtggggaggagctctccaagatcgtgctcgcctacgagcccgtc
tgggccatcggcaccggcaaggtcgcctccgccgcggatgcgcaggaggtctgcgccgcg
gtccgcgaggcgctcgctgagctgggaggggaggacgtcgccgctggcgtccgtgtcctg
tacggcggctccgttaagcgggagtccatcggcgagctgatggcccagccggacatcgac
ggcggcctggtcggcggcgcgagcctcgacggcgcggaattcgcccgcctcgtcgcggca
tccgtcagctag

DBGET integrated database retrieval system