KEGG   Corynebacterium urealyticum DSM 7109: cur_1153Help
Entry
cur_1153          CDS       T00685                                 

Gene name
glsK
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cur00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cur00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cur00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366951..1368189)
Genome map
AA seq 412 aa AA seqDB search
MKRHMVHGYLQEILEELKDSDGGEVADYIPQLATADPAPFAVALATTDGAVYSAGLNEGD
DELEFTIQSASKPFVYAAAIQERGLKKVRATVGMEPSGEAFNELSLDPGSNRPMNPMINA
GAIAVNQLINGEDSTVEERTEVIRQFLSELAGRDLEIDYLVCDSELEVADRNLSIAHMLR
SHGIIEDMAHDAVESYTQQCSIKVTVRDLAVMAATLASGGIQPLTGKRVVSPLVSRQVQA
VMSSAGMYNLAGRWMSVVGIPAKSGVSGGIMGTLPGVMGLATFSPRLDSTGNSVRGVKTF
HRLSEDMGLHLMGLRQRGDTAVRDIITREDGPNGRTTTIELQGIIDFAAAENAWRTILQE
EKLADRVVFDLSEVASVNDIGRRMVVQGFQGLRTAGRNVILKDPRKLFPELS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccacatggtgcatggttacctgcaggagatcctggaggagctgaaggactcc
gacggcggtgaggtcgcggactatatcccgcagctggcgaccgccgacccggcaccgttc
gcggtcgcgctggcgaccaccgacggcgctgtctatagcgcggggcttaacgagggggac
gatgagctggagttcacgatccagtcggcttccaagcccttcgtctatgccgcggcgatc
caggagcggggactgaaaaaggtgcgtgccacagtgggcatggagccctctggcgaggcc
ttcaacgagctcagcctcgacccgggcagcaatcggccgatgaacccgatgatcaacgcc
ggtgcgatcgcggtcaaccagctcatcaacggcgaggactccaccgtcgaggagcgcacc
gaggttatccggcagttcttgagcgagctggcgggccgggacctggagatcgactacctc
gtctgcgactccgagctggaggtcgcggaccgcaacctgtccatcgcgcacatgctgcgc
agtcacggcatcatcgaggatatggcccacgacgcggtggagagctatacccagcagtgc
tccattaaggtcacggtgcgcgacctggcggtgatggctgcgaccctggcgagcggtggt
atccagcccctgaccggtaagcgcgtggtctccccgctggtctctcggcaggtacaggcc
gtgatgtcctcagccggcatgtacaaccttgcaggccggtggatgtccgtggtcggcatc
cccgcgaagtccggtgtctccggcggcatcatgggcacgctgcccggcgtgatgggcctg
gcgactttctcgccacgtttggacagcacgggcaattcagtgcgcggcgtgaaaactttc
caccgcctctcggaagacatggggctgcacttgatgggcctgcgccagcgcggcgatacc
gcggtgcgcgacatcatcacccgtgaggacgggccgaatggtcgcaccaccactatcgaa
ctccaaggaatcattgattttgcggctgcggagaacgcgtggcgtactattcttcaagaa
gaaaagctcgccgaccgggtggtgttcgacctctccgaggtcgcttcggttaatgacatt
ggccgacgcatggtcgtccagggcttccagggcctgcgcaccgcgggccgcaacgttatc
ctcaaagacccccgaaagcttttccccgaattgtcatga

DBGET integrated database retrieval system