KEGG   Corynebacterium urealyticum DSM 7109: cur_1163Help
Entry
cur_1163          CDS       T00685                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cur_1163 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cur_1163 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cur_1163 (trpA)
Enzymes [BR:cur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cur_1163 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377301..1378074)
Genome map
AA seq 257 aa AA seqDB search
MSRLEQIFKDAKAEGRAAFVAYYPAGFPTVEESVENIIELSKHADLIEVGIPFTDPMMDG
PTIQHAADIALENGFKVKDTIEVVRRATEAGANCVVMTYWNPVLQYGPERFAAEFAEAGG
LGSIIPDLLPEMAGRWKAACDENDLDPVYLAAQSTTMERLEMTTHAGGGFIYAASHMGVT
GAQDEVDKGAQELVERCRKVTDLPVAVGLGVRDGKQAAQIAAFADGVIVGSVLINATEQG
TLVEVAADLAAGVRAKA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctggaacagatttttaaggacgccaaggccgagggacgggcggcgttcgtc
gcctactacccggccggtttcccgacggtcgaggagtccgtcgagaacatcatcgagctg
tccaagcacgcggatctcatcgaggtgggcatcccgttcacggacccgatgatggacggc
ccgaccatccagcacgccgcggacatcgccctggagaacggcttcaaggtcaaggacacc
atcgaggtcgtccgccgggctaccgaggccggcgcgaactgcgtggtcatgacttactgg
aacccggtgctgcagtacggcccggagcgcttcgccgccgagttcgctgaggccggtggc
ctgggcagcatcatcccggacctgcttccggagatggccggccgctggaaggctgcgtgt
gatgaaaacgacctggaccccgtgtacctggcggctcagtccaccacgatggagcggctg
gagatgaccacccacgctggtggtggctttatctacgcggcctcccacatgggtgtcacc
ggtgctcaggacgaggtcgataagggcgcccaggaactcgtggagcgctgccgcaaggtc
accgacctgccggtggccgtcggcctgggcgttcgcgacggcaagcaggccgcgcagatc
gcggccttcgccgacggtgtgatcgtgggctccgtcctcatcaacgctaccgagcaaggc
accctggtggaggtcgcagcagacctggccgccggcgtgcgtgccaaggcgtag

DBGET integrated database retrieval system