KEGG   Corynebacterium urealyticum DSM 7109: cur_1164Help
Entry
cur_1164          CDS       T00685                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cur_1164
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cur_1164
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cur_1164
Enzymes [BR:cur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cur_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1378075..1379331)
Genome map
AA seq 418 aa AA seqDB search
MSNNKKSPAQALPTAGEVIGTATHHEPDNLGQWGDFGGRYIPEALMAVIDEITDAWGKAK
TDPQYLDTLDDLHRNYSGRPSPLYYAERFSKHVGAQVWLKREDLNHTGSHKINNVLGQAL
LAKRMGKTRVIAETGAGQHGVATATACALLGLECRIYMGAVDAQRQAMNVARMKLLGAEV
EEVEIGSATLKDAINEAMRYWVANADDTYYCFGTAAGPHPFPQMVRDLQRIIGTEARQQI
LQGAGRLPDAVVACVGGGSNAIGLFHPFIEDESVALIGAEAAGDGMDTGRHAAPINMGRQ
GVFQGSYSDLMEDEDGQIIPSHSISAGLDYPGVGPEHSALHAEGRAEYFAITDAEAMEAF
RLLTRLEGILPAIESAHGVAAAIKYAEREDNPLIIVNVSGRGDKDVATAAKWFAKEGN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaataacaagaaaagcccagcacaagcactgcccactgccggtgaagtcatcggc
accgcgacccaccacgaacccgataacctcgggcagtggggcgacttcggtggccgttat
atcccagaggccctcatggccgtgatcgacgagatcaccgacgcctggggcaaggcgaag
accgatccgcagtacctggatacgctcgacgatctgcaccgcaactactcgggccgaccg
tctccgctgtactacgcggagcgtttctccaagcacgtgggtgcccaggtgtggctcaag
cgtgaggacctcaaccacacggggtcccacaagatcaacaacgtgctcggccaggccctg
ctggccaagcgcatgggcaagacccgcgtgatcgctgagacaggtgctggccagcacggc
gtcgcgaccgccaccgcttgtgcgctgctcggcctggagtgccgcatctacatgggggcc
gtggacgcccagcgccaggcgatgaatgtcgcccggatgaagttgctgggagcggaggtc
gaggaggtcgagatcggctccgccacgctaaaggacgcgattaacgaggccatgcgctac
tgggtggccaatgcggacgatacctactactgcttcggcaccgccgccggcccccaccca
ttcccgcagatggtgcgcgacctgcagcgcatcatcggcaccgaggcccgacagcagatc
cttcagggcgctggtcgcctcccagacgccgtggtggcctgcgtgggcggtggctcgaac
gccatcggtctgttccacccgttcatcgaagacgagtccgtcgcgctgatcggcgccgag
gccgcgggcgacggcatggacaccggccgccacgccgcacccatcaacatgggccgccag
ggcgtgttccaaggctcctattccgacttgatggaggacgaggacggccagatcatcccg
tcccactccatttccgccggactcgattacccgggtgtggggcccgagcactccgcactg
cacgctgaggggcgcgcggaatacttcgccatcaccgatgccgaggccatggaagctttc
cgcctcctgacccgcttggagggcatcctgccggccatcgagtcggcccacggtgtggcc
gctgccatcaagtacgccgagcgcgaggacaacccgttgatcatcgtcaacgtctccggc
cgcggcgataaggacgtcgcgaccgccgcgaagtggttcgcgaaggagggaaactaa

DBGET integrated database retrieval system