KEGG   Corynebacterium urealyticum DSM 7109: cur_1210Help
Entry
cur_1210          CDS       T00685                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    cur_1210
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    cur_1210
Enzymes [BR:cur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     cur_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1426277..1427878)
Genome map
AA seq 533 aa AA seqDB search
MATHQATDNSDRNTRGVTLRELAALTGGTVAATHQDVTVDSAAIGSADVQPGGLFCAVPG
SRVHGATFAADSGAAAVLTDAEGAEILADADLPLLVVDDVRRWMGPVAAAVYGHPSRDLR
IIGITGTSGKTTTTYLIERALMAKHSVGIIGTTGTRINGEQIPTKLTTPEAPTMQALLAQ
MRDRGVTHVVMEVSSHALALGRVTGIDFDVAGFTNLSQDHLDFHPTMEDYFETKAQLFLQ
AQAEGAELPAAVVCVDDDWGQRLAGMIADSGLQALTVGTTKQSGADWQVTDVHVTPAGRQ
EITVATEGEEFSYDIGLVGSFNVANSLLAISCVTQLGEDPQAAAAAIADVQVPGRMQAVD
AGQPFLAVVDYAHKPGAVAAVVRTLSDYLPSPTGRIGIVLGAGGNRDHDKRPMMGEEAAK
VADAVFVTDDNPRDEEPAPIRSMILDGVRKAAEAREANGEKVFYDDVPGRADAIRAAVAW
ARPGDAIVVAGKGHETGQEVRGEIHPFADLEELAAALEQRAGVDQQASTKIRD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccaccaggccactgacaattccgaccgcaacacccgcggggtaaccctccgc
gaactcgcggcactgaccggcggtacggtcgccgctacccatcaggacgtcaccgtcgac
tccgccgccatcggttccgcggacgtccagcccggcggcctgttctgcgccgttccgggt
agccgcgtccacggcgcgaccttcgcagcagacagcggggccgctgccgtcctcacggat
gccgagggcgcggagatcctcgccgatgcggacctcccgctgctggtcgtcgacgacgtc
cggcgctggatggggccggtcgccgcggcggtctacggccacccgagccgcgacctgcgc
atcatcggcatcaccggaacctcgggtaagaccaccacgacgtacctcatcgagcgcgcc
ctgatggccaagcacagcgtcggcatcatcggcaccaccggcacccgaatcaatggcgag
cagatccccacgaagctcaccacccccgaggcgccgaccatgcaggctctgctggcgcag
atgcgcgaccgcggggtcacccacgtggtcatggaggtcagctcgcatgcgctcgcgctg
gggcgggtgaccggcatcgatttcgacgtcgccggcttcaccaacttgagccaggaccac
ctggatttccacccgacgatggaggactacttcgagacgaaggcccagctgttcctccag
gctcaggccgagggcgcggagctgcctgccgccgtggtctgcgtcgacgacgactggggc
cagcgcctcgccggcatgattgcagactccggactccaggccctcaccgtgggcaccacg
aagcagtccggcgcggattggcaggtcaccgacgtgcacgtcaccccggccggccgccag
gagatcaccgtagccaccgagggcgaggaattcagctacgacatcggcctggtcggctct
ttcaacgtggccaacagcctgctggcgatcagctgcgtgacgcagctgggggaggacccg
caagccgcagcagcggccatcgcggatgtgcaggtgccgggccgcatgcaggccgtggac
gccgggcagcccttcctcgcggtggtggactacgcccacaagccgggcgccgtcgccgcc
gtcgtccggaccctgagcgactacctgccgtccccgacggggcgcatcggcattgtgctg
ggagccggcggtaaccgtgaccacgacaagcgccccatgatgggcgaggaggccgcgaag
gtcgccgacgccgtcttcgtcaccgacgacaacccgcgcgatgaagaacccgccccgatt
cggtcgatgatcctggacggggtgcgcaaggcagccgaggcccgcgaggcgaacggcgag
aaggtcttttatgacgacgtcccgggccgcgcggacgccatccgcgcggcggtcgcatgg
gctcgccctggtgatgcgatcgtggtggcaggcaaggggcacgagaccggccaggaggtc
cgcggggaaatccacccgttcgccgacctcgaggagctcgccgcagcacttgagcagcgg
gcgggcgttgaccagcaggcaagcacgaagatccgcgactaa

DBGET integrated database retrieval system