KEGG   Corynebacterium urealyticum DSM 7109: cur_1247Help
Entry
cur_1247          CDS       T00685                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_1247 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cur_1247 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    cur_1247 (aceF)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cur_1247 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471093..1473282
Genome map
AA seq 729 aa AA seqDB search
MAQSVEMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVSTDKVDTEIPSPVAGILLKVM
AEEDDTIEVGSVIAEIGEEDEAPSSDDEGDDSSNEDEAADSSDEEAEDSSEDSSSDDASE
GSGEGEDVTMPELGESVTEGTITQWLKSVGDKVEVDEPLLEVSTDKVDTEIPSPVAGTLV
EILAEEDDTVEVGDVIARIGDGEAKPAKKEEPKAEEPEETEDEDAEASSEDASEDTSADE
SSDDSASEGSGEDEDVTMPELGESVTEGTITQWLKSVGDKVEVDEPLLEVSTDKVDTEIP
SPVAGTLVEILAEEDDTVEVGDVIARIGDGSGKPSKKEEPKKEKSEDKSSEKAKAKDEQK
SEKKDDSKDEQKSEKKDSGKDKAAAAREAAREKAAKTTARPNVADRGEKSGSAGEPSGDN
LPYVTPLVRKLAEKNNVDLSKVTGTGVGGRIRKQDVLAAAEGEDITTGAKTNLPAGPRAS
AHKVDPDKQELIGTTQKVNRIREITARTTLESLRNSAQLTQVHEVDMTLVADLRAKSKKA
FQDAHGVNLTFLPFFAKAAVEALISHPNVNASYNAETKEMTYHDRVNLSIAVDTEDGLLS
PVIHDAQDLSLPELAKAIADIADRARNKKLKPNDLAGGTFTITNIGSEGALTDTPILVPP
QAAMVGTGAIVKRPVVLTEDENEAIAIRDMVFLPMTYDHQVIDGADAGRFMSTLRDRLEK
GDFEDDLEL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtccgtcgaaatgcccgagttgggcgaatcggtcactgagggcaccatcacc
cagtggctgaagaaggttggcgacaaggtagaggtggatgagcctttgctcgaggtgtcc
accgacaaggttgataccgagatcccctcccctgttgccggcattctgctgaaggtaatg
gccgaagaggacgacaccatcgaggtcggttccgtcatcgctgagatcggcgaggaggat
gaagctccttcctccgatgacgagggcgacgactcctccaacgaggacgaggctgcggac
agctccgacgaggaggctgaggactcctccgaggactcctcctccgatgatgcatccgag
ggttccggtgagggcgaggacgtcaccatgccggagctcggcgagtccgtcaccgagggc
accatcacccagtggctgaagtccgtcggcgacaaggtcgaggtcgacgagccactgctc
gaggtctccaccgacaaggtcgacaccgagatcccatccccggtcgcaggcaccctggtc
gagatcctcgctgaggaggacgacaccgtcgaggtcggcgacgtcatcgcccgcatcggc
gacggcgaggctaagccggccaagaaggaagagccgaaggctgaggagccggaggagacc
gaggacgaggacgctgaggcttcctccgaggacgcatccgaggacacctccgccgatgag
tcttccgacgattccgcttccgagggttccggtgaggacgaggacgtcaccatgccggag
ctcggcgagtccgtcaccgagggcaccatcacccagtggctgaagtccgtcggcgacaag
gtcgaggtcgacgagccactgctcgaggtctccaccgacaaggtcgacaccgagatccca
tccccggtcgcaggcaccctggtcgagatcctcgctgaggaagacgacaccgtcgaggtc
ggcgacgtcatcgcccgcatcggcgacggctccggcaagccttccaagaaggaagagccg
aagaaggagaagtccgaggacaagtcttccgagaaggctaaggcgaaggacgagcagaag
tccgagaagaaggacgactccaaggacgagcagaagtccgagaagaaggactccggcaag
gacaaggccgcggccgcccgcgaggcggcacgcgagaaggctgcgaagaccaccgctcgc
ccgaacgtcgccgaccgcggcgagaagtccggctccgctggcgagccgtccggcgataac
ctgccgtacgtgaccccgctggtccgcaagctggccgaaaagaacaacgtggacctctcc
aaggtcaccggcaccggcgttggtggccgcatccgcaagcaggacgtcctggccgccgcc
gagggcgaggacatcaccaccggcgcgaagaccaacctgccggccggcccgcgtgcgtcc
gcacacaaggtcgacccggataagcaggagctgatcggcacgacccagaaggtcaaccgc
atccgcgagatcacggcacgcaccaccctggagtccctgcgcaactccgcgcagctgacc
caggtccacgaggtcgacatgaccctcgtcgccgacctgcgcgcgaagtccaagaaggct
ttccaggacgcccacggcgtgaacctgaccttcctgccgttcttcgcgaaggctgccgtc
gaggcgctcatctcccacccgaacgtcaacgcatcctacaacgctgagaccaaggagatg
acctaccacgaccgcgtgaacctgagcatcgcggtggacaccgaggacggcctgctctcc
ccggtcatccacgacgcgcaggacctgagcctgccggagctggcgaaggccatcgcggac
atcgctgaccgcgcacgcaacaagaagctgaagccgaacgatctggccggtggcaccttc
accatcaccaacatcggttccgagggcgccctgaccgacaccccgatcctggttccgccg
caggcagccatggtcggcaccggtgcgatcgtgaagcgcccggtcgtcctcaccgaggac
gagaacgaggccatcgccatccgcgacatggtcttcctgccgatgacctacgaccaccag
gtcatcgacggcgccgacgcaggccgcttcatgtccaccctgcgtgaccgcctggagaag
ggcgacttcgaggatgacctggagctctaa

DBGET integrated database retrieval system