KEGG   Corynebacterium urealyticum DSM 7109: cur_1247Help
Entry
cur_1247          CDS       T00685                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cur01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cur00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cur00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471093..1473282
Genome map
AA seq 729 aa AA seqDB search
MAQSVEMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVSTDKVDTEIPSPVAGILLKVM
AEEDDTIEVGSVIAEIGEEDEAPSSDDEGDDSSNEDEAADSSDEEAEDSSEDSSSDDASE
GSGEGEDVTMPELGESVTEGTITQWLKSVGDKVEVDEPLLEVSTDKVDTEIPSPVAGTLV
EILAEEDDTVEVGDVIARIGDGEAKPAKKEEPKAEEPEETEDEDAEASSEDASEDTSADE
SSDDSASEGSGEDEDVTMPELGESVTEGTITQWLKSVGDKVEVDEPLLEVSTDKVDTEIP
SPVAGTLVEILAEEDDTVEVGDVIARIGDGSGKPSKKEEPKKEKSEDKSSEKAKAKDEQK
SEKKDDSKDEQKSEKKDSGKDKAAAAREAAREKAAKTTARPNVADRGEKSGSAGEPSGDN
LPYVTPLVRKLAEKNNVDLSKVTGTGVGGRIRKQDVLAAAEGEDITTGAKTNLPAGPRAS
AHKVDPDKQELIGTTQKVNRIREITARTTLESLRNSAQLTQVHEVDMTLVADLRAKSKKA
FQDAHGVNLTFLPFFAKAAVEALISHPNVNASYNAETKEMTYHDRVNLSIAVDTEDGLLS
PVIHDAQDLSLPELAKAIADIADRARNKKLKPNDLAGGTFTITNIGSEGALTDTPILVPP
QAAMVGTGAIVKRPVVLTEDENEAIAIRDMVFLPMTYDHQVIDGADAGRFMSTLRDRLEK
GDFEDDLEL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtccgtcgaaatgcccgagttgggcgaatcggtcactgagggcaccatcacc
cagtggctgaagaaggttggcgacaaggtagaggtggatgagcctttgctcgaggtgtcc
accgacaaggttgataccgagatcccctcccctgttgccggcattctgctgaaggtaatg
gccgaagaggacgacaccatcgaggtcggttccgtcatcgctgagatcggcgaggaggat
gaagctccttcctccgatgacgagggcgacgactcctccaacgaggacgaggctgcggac
agctccgacgaggaggctgaggactcctccgaggactcctcctccgatgatgcatccgag
ggttccggtgagggcgaggacgtcaccatgccggagctcggcgagtccgtcaccgagggc
accatcacccagtggctgaagtccgtcggcgacaaggtcgaggtcgacgagccactgctc
gaggtctccaccgacaaggtcgacaccgagatcccatccccggtcgcaggcaccctggtc
gagatcctcgctgaggaggacgacaccgtcgaggtcggcgacgtcatcgcccgcatcggc
gacggcgaggctaagccggccaagaaggaagagccgaaggctgaggagccggaggagacc
gaggacgaggacgctgaggcttcctccgaggacgcatccgaggacacctccgccgatgag
tcttccgacgattccgcttccgagggttccggtgaggacgaggacgtcaccatgccggag
ctcggcgagtccgtcaccgagggcaccatcacccagtggctgaagtccgtcggcgacaag
gtcgaggtcgacgagccactgctcgaggtctccaccgacaaggtcgacaccgagatccca
tccccggtcgcaggcaccctggtcgagatcctcgctgaggaagacgacaccgtcgaggtc
ggcgacgtcatcgcccgcatcggcgacggctccggcaagccttccaagaaggaagagccg
aagaaggagaagtccgaggacaagtcttccgagaaggctaaggcgaaggacgagcagaag
tccgagaagaaggacgactccaaggacgagcagaagtccgagaagaaggactccggcaag
gacaaggccgcggccgcccgcgaggcggcacgcgagaaggctgcgaagaccaccgctcgc
ccgaacgtcgccgaccgcggcgagaagtccggctccgctggcgagccgtccggcgataac
ctgccgtacgtgaccccgctggtccgcaagctggccgaaaagaacaacgtggacctctcc
aaggtcaccggcaccggcgttggtggccgcatccgcaagcaggacgtcctggccgccgcc
gagggcgaggacatcaccaccggcgcgaagaccaacctgccggccggcccgcgtgcgtcc
gcacacaaggtcgacccggataagcaggagctgatcggcacgacccagaaggtcaaccgc
atccgcgagatcacggcacgcaccaccctggagtccctgcgcaactccgcgcagctgacc
caggtccacgaggtcgacatgaccctcgtcgccgacctgcgcgcgaagtccaagaaggct
ttccaggacgcccacggcgtgaacctgaccttcctgccgttcttcgcgaaggctgccgtc
gaggcgctcatctcccacccgaacgtcaacgcatcctacaacgctgagaccaaggagatg
acctaccacgaccgcgtgaacctgagcatcgcggtggacaccgaggacggcctgctctcc
ccggtcatccacgacgcgcaggacctgagcctgccggagctggcgaaggccatcgcggac
atcgctgaccgcgcacgcaacaagaagctgaagccgaacgatctggccggtggcaccttc
accatcaccaacatcggttccgagggcgccctgaccgacaccccgatcctggttccgccg
caggcagccatggtcggcaccggtgcgatcgtgaagcgcccggtcgtcctcaccgaggac
gagaacgaggccatcgccatccgcgacatggtcttcctgccgatgacctacgaccaccag
gtcatcgacggcgccgacgcaggccgcttcatgtccaccctgcgtgaccgcctggagaag
ggcgacttcgaggatgacctggagctctaa

DBGET integrated database retrieval system