KEGG   Corynebacterium urealyticum DSM 7109: cur_1247Help
Entry
cur_1247          CDS       T00685                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_1247 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cur_1247 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    cur_1247 (aceF)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cur_1247 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471093..1473282
Genome map
AA seq 729 aa AA seqDB search
MAQSVEMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVSTDKVDTEIPSPVAGILLKVM
AEEDDTIEVGSVIAEIGEEDEAPSSDDEGDDSSNEDEAADSSDEEAEDSSEDSSSDDASE
GSGEGEDVTMPELGESVTEGTITQWLKSVGDKVEVDEPLLEVSTDKVDTEIPSPVAGTLV
EILAEEDDTVEVGDVIARIGDGEAKPAKKEEPKAEEPEETEDEDAEASSEDASEDTSADE
SSDDSASEGSGEDEDVTMPELGESVTEGTITQWLKSVGDKVEVDEPLLEVSTDKVDTEIP
SPVAGTLVEILAEEDDTVEVGDVIARIGDGSGKPSKKEEPKKEKSEDKSSEKAKAKDEQK
SEKKDDSKDEQKSEKKDSGKDKAAAAREAAREKAAKTTARPNVADRGEKSGSAGEPSGDN
LPYVTPLVRKLAEKNNVDLSKVTGTGVGGRIRKQDVLAAAEGEDITTGAKTNLPAGPRAS
AHKVDPDKQELIGTTQKVNRIREITARTTLESLRNSAQLTQVHEVDMTLVADLRAKSKKA
FQDAHGVNLTFLPFFAKAAVEALISHPNVNASYNAETKEMTYHDRVNLSIAVDTEDGLLS
PVIHDAQDLSLPELAKAIADIADRARNKKLKPNDLAGGTFTITNIGSEGALTDTPILVPP
QAAMVGTGAIVKRPVVLTEDENEAIAIRDMVFLPMTYDHQVIDGADAGRFMSTLRDRLEK
GDFEDDLEL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtccgtcgaaatgcccgagttgggcgaatcggtcactgagggcaccatcacc
cagtggctgaagaaggttggcgacaaggtagaggtggatgagcctttgctcgaggtgtcc
accgacaaggttgataccgagatcccctcccctgttgccggcattctgctgaaggtaatg
gccgaagaggacgacaccatcgaggtcggttccgtcatcgctgagatcggcgaggaggat
gaagctccttcctccgatgacgagggcgacgactcctccaacgaggacgaggctgcggac
agctccgacgaggaggctgaggactcctccgaggactcctcctccgatgatgcatccgag
ggttccggtgagggcgaggacgtcaccatgccggagctcggcgagtccgtcaccgagggc
accatcacccagtggctgaagtccgtcggcgacaaggtcgaggtcgacgagccactgctc
gaggtctccaccgacaaggtcgacaccgagatcccatccccggtcgcaggcaccctggtc
gagatcctcgctgaggaggacgacaccgtcgaggtcggcgacgtcatcgcccgcatcggc
gacggcgaggctaagccggccaagaaggaagagccgaaggctgaggagccggaggagacc
gaggacgaggacgctgaggcttcctccgaggacgcatccgaggacacctccgccgatgag
tcttccgacgattccgcttccgagggttccggtgaggacgaggacgtcaccatgccggag
ctcggcgagtccgtcaccgagggcaccatcacccagtggctgaagtccgtcggcgacaag
gtcgaggtcgacgagccactgctcgaggtctccaccgacaaggtcgacaccgagatccca
tccccggtcgcaggcaccctggtcgagatcctcgctgaggaagacgacaccgtcgaggtc
ggcgacgtcatcgcccgcatcggcgacggctccggcaagccttccaagaaggaagagccg
aagaaggagaagtccgaggacaagtcttccgagaaggctaaggcgaaggacgagcagaag
tccgagaagaaggacgactccaaggacgagcagaagtccgagaagaaggactccggcaag
gacaaggccgcggccgcccgcgaggcggcacgcgagaaggctgcgaagaccaccgctcgc
ccgaacgtcgccgaccgcggcgagaagtccggctccgctggcgagccgtccggcgataac
ctgccgtacgtgaccccgctggtccgcaagctggccgaaaagaacaacgtggacctctcc
aaggtcaccggcaccggcgttggtggccgcatccgcaagcaggacgtcctggccgccgcc
gagggcgaggacatcaccaccggcgcgaagaccaacctgccggccggcccgcgtgcgtcc
gcacacaaggtcgacccggataagcaggagctgatcggcacgacccagaaggtcaaccgc
atccgcgagatcacggcacgcaccaccctggagtccctgcgcaactccgcgcagctgacc
caggtccacgaggtcgacatgaccctcgtcgccgacctgcgcgcgaagtccaagaaggct
ttccaggacgcccacggcgtgaacctgaccttcctgccgttcttcgcgaaggctgccgtc
gaggcgctcatctcccacccgaacgtcaacgcatcctacaacgctgagaccaaggagatg
acctaccacgaccgcgtgaacctgagcatcgcggtggacaccgaggacggcctgctctcc
ccggtcatccacgacgcgcaggacctgagcctgccggagctggcgaaggccatcgcggac
atcgctgaccgcgcacgcaacaagaagctgaagccgaacgatctggccggtggcaccttc
accatcaccaacatcggttccgagggcgccctgaccgacaccccgatcctggttccgccg
caggcagccatggtcggcaccggtgcgatcgtgaagcgcccggtcgtcctcaccgaggac
gagaacgaggccatcgccatccgcgacatggtcttcctgccgatgacctacgaccaccag
gtcatcgacggcgccgacgcaggccgcttcatgtccaccctgcgtgaccgcctggagaag
ggcgacttcgaggatgacctggagctctaa

DBGET integrated database retrieval system