KEGG   Corynebacterium urealyticum DSM 7109: cur_1285Help
Entry
cur_1285          CDS       T00685                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cur_1285 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cur_1285 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    cur_1285 (thrC)
Enzymes [BR:cur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     cur_1285 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1516394..1517845)
Genome map
AA seq 483 aa AA seqDB search
MDYFSTRDSSRTPAKFSDILLGGLAPDGGLYLPAEYPQLSDETLTEWRELLAEKGYAALA
AEVLKIFVDDIPAEDLEAITARAYTTKAFAHEEIVPVTELEDGMYLGHLSEGPTAAFKDM
AMQLLGELFEYELARRGETLNILGATSGDTGSAAEYAMRGRQGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADADFKRDNRIGAVNSINWARLMAQVVYY
ISSWLKLTESNDQKISFSVPTGNFGDICAGHIAKQMGLPIERLIVATNENDVLDEFFRTG
EYRVRSSAETLKTSSPSMDISRASNFERFVFDLLGRDADRVADLFGVKVREGGFSLADEP
AFPEAAATYGFASGTSSHADRVATIRDLHERLGVIIDPHTADGVKAAQQWRDQVEGPIVV
LETALPVKFAETIEEAIGEVPEVPERFAGIMDADRHVVDLPNDAERVKQYILDSIAETKE
VEN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtggactacttttcgactcgtgattcttcccgtacccccgccaagttctcggacatcctg
ctgggcggcctggccccggacggcggcctctacctgcccgccgaatacccgcagctgagc
gacgagaccctcaccgagtggcgcgagctgctcgcggagaagggctatgccgcgctggct
gccgaggtgctgaagatttttgtggacgacatcccggccgaggacctggaggccatcacg
gcccgggcgtatacgacgaaggctttcgcgcacgaggagatcgtccccgtcacggagctc
gaggacggcatgtacctgggccacctctcggagggaccgacggctgcttttaaggacatg
gccatgcagctgctcggcgagctgtttgagtacgagctggcccgccgcggcgagaccctg
aacatcctgggcgcgaccagcggtgacacgggttcggcggcggagtacgccatgcgtggc
cgccaggggatccgcgtgttcatgctgaccccggccgggcgcatgacgcccttccagcag
gcgcagatgttcggcctggatgatccgaatatcttcaacatcgccctggacggggtcttc
gatgactgccaggacgtggtcaaggccgtgtccgcggatgcggatttcaagcgggataac
cgcatcggtgcggtgaactccatcaactgggcgcgcctgatggcccaggtcgtgtactac
atctcctcctggctgaagctgacggagtcgaatgatcagaagatcagcttctccgtgccg
accggcaatttcggcgacatctgcgcaggccacatcgccaagcagatgggcctgccgatc
gagcggttgatcgtcgcgacgaatgaaaacgacgtgctggatgagttcttccgcaccggc
gagtaccgggtgcgcagctccgcggagacgctgaagacctccagcccttcgatggatatt
tcccgtgcctcgaacttcgagcgtttcgttttcgacctgctgggtcgggacgccgatcgg
gtggcggacctgttcggtgtgaaggtgcgcgagggcgggttctccctggccgacgaaccg
gcgttcccggaggcagcggcgacgtacggtttcgcgtccggtacctcttcgcatgcggat
cgcgtggcgacgattcgggatctgcacgagcgcctgggcgtgatcatcgacccgcacacc
gccgatggtgtgaaggccgcgcagcagtggcgtgaccaggttgagggcccgatcgtggtc
ctggagacggcgctgccggtgaagttcgcggagaccatcgaggaggccatcggggaggtc
cctgaggttccggagcgcttcgccgggattatggacgctgaccgccacgtggttgacctg
ccgaacgacgctgagcgcgtgaagcagtacatcctggactccatcgcggagaccaaggaa
gtcgagaactag

DBGET integrated database retrieval system