KEGG   Corynebacterium urealyticum DSM 7109: cur_1318Help
Entry
cur_1318          CDS       T00685                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cur  Corynebacterium urealyticum DSM 7109
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    cur_1318
Enzymes [BR:cur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     cur_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1559803..1561530
Genome map
AA seq 575 aa AA seqDB search
MTATHYDVLIIGSGFGGSVTALRLVEKGYKVGVLEAGKRYADKDFAKNSWHLKQFLWAPV
IGCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYQPEDEYFRNKQWAHITDWKDELTPY
YDQARRMLGVVTNPTMTPADKLSKQTAEELGVGDTFRMAPVGVFFGEKVGLNGKPKQTVE
DPYFGGAGPQRTACHECGECMTGCRHGAKNTLLKNYLYLAEKGGAEVHPLTTVTDITRKP
GGGWNVDTKTTGGLLGKKKTRRFTADKVVVAAGAWGTQNLLHRQKINGNLPQLPDSLGTM
TRTNSEALLGAQFKKYDPEWDFSEGVAITSSYFPAPDTHIEPVRYGKGSNSMGLLQTLMT
DGDKLRPRVLEFLRQLVLQFRQIPRLVNLRRWSQRTVINLVMQSRDNSLTTYPRTLGKFT
WLTSKQGTGEPNPSWIPEGNKATRILASLRKGGLAGGVWSEVVDIPLTAHFLGGCSISSS
PADGVVDPYHRVWGLPDLFVVDGSSMAANPGVNPSLSITANAERAAAMWPNKGEEDPRPE
QSEGYQRIEAVEPASPMVPATAPAALRLPITPVGN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacccactacgacgtcctcatcatcggctccggcttcggcggctccgtcacc
gccctacgcctcgtcgagaagggatacaaggtcggtgtcctcgaggccggcaagcgctac
gcggacaaggacttcgcgaagaactcctggcacctcaagcagttcctctgggcacccgtg
atcggctgctacggcatccagcgcatccacctgctgcgcaacgtcatgatcctcgccggc
gccggtgtcggcggcggttcgctgaactacgccaacaccctctaccagcccgaggacgag
tacttccgcaataagcagtgggcacacatcaccgactggaaggacgagctgaccccctac
tacgaccaggcacgccgcatgctgggtgtggtcaccaaccccaccatgaccccggcggac
aaactctcgaagcagaccgccgaggaactcggcgtgggcgataccttccgcatggctccg
gtgggcgtattcttcggcgaaaaggtggggctgaacggcaagccgaaacagaccgtggag
gacccctacttcggtggcgcaggcccgcagcgcaccgcctgccacgagtgcggcgagtgc
atgaccggctgccgccacggggcgaagaacaccctgctgaagaactacctctacctcgcc
gagaagggcggggccgaggtccacccgctgaccacggtcaccgacatcacccgcaaaccg
ggcggcggctggaacgtggatacgaagaccacgggaggcctgctgggcaagaagaagacc
cgccgattcaccgcggacaaggtcgtcgtcgccgcgggtgcgtggggcacccagaaccta
ctgcaccggcagaagatcaacggcaacctaccgcagctgccggactccctcggcacgatg
acccgcaccaactccgaggccctgctcggcgcgcagttcaaaaagtacgacccggagtgg
gatttctccgagggcgtggccatcacctccagctacttccccgccccggatacccacatt
gaaccagtccgctacggcaagggctcgaactccatgggcctgctgcagaccctcatgacc
gacggcgacaaactgcgcccccgcgtgctcgagttcctccgccagctggttctccagttc
cgccagatccctcgcctggtgaacctgcgccgctggtcgcagcgcacggtgatcaacctg
gtgatgcagtcccgcgataactcgctgaccacctacccgcgcacgctcgggaagttcacc
tggctgacctccaagcagggcaccggcgagccgaaccccagctggatcccggagggcaat
aaggccacccgcatcctggcctccctgcgcaagggtggcctggcaggcggggtgtggtcc
gaggtggtcgacatccccctgaccgcccacttcctcggcggttgttcaatctccagctcc
ccggccgacggcgtggtggacccctatcaccgcgtgtgggggctgccggatctattcgtg
gtcgacggctcgtccatggccgccaaccccggcgtgaacccttctctgtccatcaccgcc
aacgcggagcgcgccgctgcgatgtggccgaataagggcgaggaggacccgcggccggag
cagtccgagggctatcagcgcatcgaggccgtggagccggcctccccgatggttcctgcc
accgccccggccgcgctgcgcctgccgatcaccccggtgggcaactag

DBGET integrated database retrieval system