KEGG   Corynebacterium urealyticum DSM 7109: cur_1361Help
Entry
cur_1361          CDS       T00685                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_1361
   01230 Biosynthesis of amino acids
    cur_1361
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cur_1361
  Energy metabolism
   00680 Methane metabolism
    cur_1361
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cur_1361
Enzymes [BR:cur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     cur_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1607779..1608552)
Genome map
AA seq 257 aa AA seqDB search
MTANASQRRLILMRHGETEYNSAGRMQGQLDTPLSDVGRQQARDVAAVARDWNVTKVVAS
DLERAVETASIVAEAWGLDVDVDPRFRETHLGDWQGGSHTEIDEQYPGQRAYWRHDPRWS
PPRGETRLEVAERTAAGIADLMASDSFEGTVLVVAHGGSIAALTSRLLDVPAEHYPVFAR
LGNARWAELVARPHFPMTELGDGPQTAPAVDGSTVPEVPNAAAEWWRTPRWYLEGWNVGV
QVSGQQLDNPDEGGAAR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaacgcgagccagcgcaggctcatcctgatgcgccacggagagacggagtac
aactccgcagggcgcatgcagggtcagctggacaccccgctatcagacgtcggccggcag
caagcccgtgacgtcgccgcggtggctcgcgactggaacgtcacgaaggtggtcgcctcc
gacctggagcgcgcggtggagacggcgagcatcgtcgccgaggcctgggggctggatgtt
gacgtcgatccccggttccgggaaacccacctgggagactggcagggcggatcccacacc
gagatcgacgagcagtaccccggccagcgagcgtattggcgccacgatccgcgctggtca
ccgcctcgtggggagacccggctggaagtggctgaacgcaccgcggcggggatcgcggac
cttatggcctccgattccttcgaaggcaccgtgctggtggtggcacatggtgggtcgatc
gcggcgctgacttcgcgcttgctggacgtgccggcggagcactacccggtattcgcccgg
cttggcaacgcgcgctgggcagaattggtggcgcgcccgcacttcccgatgactgagctg
ggggacgggccgcagaccgcgcctgcggtggatggttccaccgtcccggaggtaccgaac
gctgcggccgagtggtggcgcaccccgcgctggtacctggaaggctggaacgtcggagtg
caggtttcgggccaacaactggataacccggatgaagggggagcagcacggtga

DBGET integrated database retrieval system