KEGG   Corynebacterium urealyticum DSM 7109: cur_1519Help
Entry
cur_1519          CDS       T00685                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    cur_1519
Enzymes [BR:cur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     cur_1519
Transfer RNA biogenesis [BR:cur03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    cur_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1778333..1779121
Genome map
AA seq 262 aa AA seqDB search
MTQGLGPGDALDDATLCARLARSTGDILTSIRTAGAPDPLLVDSDGLGKSGDKVAQAWIA
RVLSLHRPDDAILSEEAEDDPSRLNKSRVWVIDPLDGTREYASARNDWAVHIALAVDGEV
AESAVGMPEMHTVYTAADYREGRVKADFGELNNRLVISQNSTPQIAVDVAEDLGMEITRL
GSCGAKAMSVVRGENDAYIHAGGQYEWDNAAPIGVALAAGLHCSRLDGSPATYNEPDPYL
PDLVICRKEIAEDLLASIQKFL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaggactaggcccaggcgacgcgctcgatgatgccactctttgcgcccgtttg
gcccgcagcaccggggatatcctcaccagtattcgcactgctggtgcgcccgaccccctc
ctggtggactccgacgggctcggtaagtcaggcgataaggtcgcccaggcctggatcgcg
cgtgtgctgagcctgcaccgccccgatgacgccatcctgtccgaggaggcggaggacgac
ccttcccgcctgaacaagtcccgggtgtgggtgatcgacccgctggacggcacccgcgaa
tacgccagcgcccgcaatgattgggccgtgcacatcgcgctcgcggtcgacggcgaggtt
gccgagtccgcggtcggcatgccggaaatgcacaccgtctacactgcggccgactaccgg
gagggccgggtgaaggctgacttcggtgagctgaacaaccgcctcgtcatcagccaaaat
tccactccacagatcgcggtagacgtggccgaggatctgggcatggagatcacccgcctg
ggctcctgcggcgcgaaggccatgagcgtggtgcgtggggaaaacgatgcgtatatccac
gccggaggccagtacgagtgggataacgccgccccgatcggcgtcgccctagcagcagga
ctgcactgcagccgcctggatggatcgcccgcgacatataacgagccggatccgtacttg
ccggacttggtaatctgtcgcaaggaaatcgccgaggacctgctggcgagcatccagaag
ttcctctag

DBGET integrated database retrieval system