KEGG   Corynebacterium urealyticum DSM 7109: cur_1548Help
Entry
cur_1548          CDS       T00685                                 

Gene name
echA2
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    cur_1548 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cur_1548 (echA2)
   00650 Butanoate metabolism
    cur_1548 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    cur_1548 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cur_1548 (echA2)
   00310 Lysine degradation
    cur_1548 (echA2)
   00360 Phenylalanine metabolism
    cur_1548 (echA2)
   00380 Tryptophan metabolism
    cur_1548 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cur_1548 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cur_1548 (echA2)
   00281 Geraniol degradation
    cur_1548 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cur_1548 (echA2)
   00627 Aminobenzoate degradation
    cur_1548 (echA2)
   00930 Caprolactam degradation
    cur_1548 (echA2)
Enzymes [BR:cur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     cur_1548 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1801988..1802785)
Genome map
AA seq 265 aa AA seqDB search
MNKNDSGAGQATVRVGFSEEQGPYGERQVGVITLDRPEKRNALRTAECLAIADGVRELVD
AGARAILLTGTGPVLCAGADLGGGVYEDGFERAVEAMLHAVLAAPVPIIADVFGPAIGAG
CQLILACDLRVFQDQGECWVPVARHGFALDEWTHSRAVELMGGAWARNVFLGGAHLSAEQ
ARAAGFAIDPRGATAEQFAAKIAAQAPLSMEHSKATLNSLGDDGVTREKTRVRLQELFST
TWASEDAAEARAARREGRAPKFHGR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagaatgattccggcgcgggtcaggccacggtccgtgtcggcttttccgaggag
caaggaccgtacggcgagcgccaggtcggggtgattaccctcgaccggcccgagaagcgc
aatgccttgcgcacggcggagtgcctcgccatcgcggacggtgtgcgcgagctggtggat
gcgggcgcgcgagcgatccttctcacgggcaccggcccagtcttgtgtgccggcgccgat
ctcgggggcggggtgtacgaagatggcttcgaaagagccgtcgaggccatgttgcacgca
gtattggcggcgccagtgccgatcatcgcggatgttttcgggcctgcgatcggggctgga
tgccagctcatcctcgcctgtgacctgcgggttttccaggatcagggggagtgctgggtt
cccgtggcgcgccacggcttcgccctcgatgagtggacgcacagccgcgccgtggagctc
atgggaggggcatgggcccgcaatgtttttctcggtggggcgcacctcagtgccgagcag
gcccgcgcggcgggctttgctatcgacccgcgcggtgcgaccgcggagcagttcgccgcc
aagatcgcggcccaggcacccctatcgatggagcattccaaggcgacgctgaactcgctg
ggcgacgacggggtcacgcgggagaagacccgggtccgcctgcaggagcttttctccact
acctgggccagtgaggacgcggccgaggcgcgggcggcccggcgcgaggggcgggcgccg
aagtttcacggccgctaa

DBGET integrated database retrieval system