KEGG   Corynebacterium urealyticum DSM 7109: cur_1638Help
Entry
cur_1638          CDS       T00685                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cur00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cur00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cur02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1909512..1911275)
Genome map
AA seq 587 aa AA seqDB search
MATLTRRRVLQGMAATGGAAAAGSLLPVVDAAPARTVLGAENWDPEVFAHSVASGDPTAS
AVIIWTRVTPTKDAQPGSGKGPDVPVTWEVATDPEFQDVAASGTVTASAEFDHTVKVDAT
GLGSGTTYFYRFTADLGQRKATSRVGRTRTAPGSGDEVSAIRFGVCSCANYEAGFFRSYR
DMAERDDLEFVLHLGDYTYEYETGGYKGMYGETVRKVEPAHQTKTLTDFRIRQAVHHRDS
DLADLHAAKPMICMWDDHEFADNNWREGATGTSFKKGDDYSALKQAASRAYFEWMPVRVR
PEARAQHLYRTLQYGPLMEIIIPDLRSYRDAQLIQSGDHLLDSDPDFIRAAGREGRTMMG
RSQFEWFSNAIKSSTAKWQVIANAVMFAPMTLPESLDPKLHTWLVEKIGLPEQGIPLNPD
QWDGYMAERQKIIDMIAGLPDKNVVFLTGDIHTSWASDIPRDVFGYRTGQNTKAVATEFV
TPSVTANSAFDSLAVSRAFDAATRQLLYTGENLLSGLNRWFKWINLTHHGYMAVEVGQEA
TQCDWHFVDHVLAKDTPFRLGNSFRAEVGSPGARSVAAGLSRAQRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcttacccgccgccgcgtcttgcagggcatggccgccaccggtggggcagcc
gccgctggcagcttgctgcccgtcgttgatgcagcccccgcccgcaccgtgctgggcgca
gagaactgggaccccgaggtcttcgcccactccgtcgcctccggggatccgaccgccagt
gccgtcatcatctggactcgcgtgaccccaacgaaggacgcgcagcccggctcggggaag
gggccggacgtccccgtgacgtgggaggtcgccaccgacccggaatttcaggacgtcgcc
gcgtccgggacggtcaccgccagcgccgagttcgaccacaccgtcaaggtcgacgccacc
ggcctcggatcgggcaccacatacttttatcgcttcacggccgacctggggcagcgcaag
gccacctcccgggtggggcgcacccgcaccgccccgggctccggcgacgaagtcagcgcg
atccgcttcggcgtgtgcagctgtgcgaactacgaggccggattcttccgcagctaccgg
gacatggctgagcgcgatgacctggaattcgtcctgcaccttggcgactacacctatgag
tacgagacgggcggctataaggggatgtatggcgagactgtccgcaaggttgagcctgca
catcaaacaaaaactctgacggacttccgaattcgtcaagcggtacaccaccgtgattca
gaccttgcagatttgcatgccgccaagccaatgatctgcatgtgggatgatcacgagttc
gctgataacaattggcgtgagggcgctaccggaacgagttttaagaagggcgatgactat
tccgccctgaagcaggctgcctcccgcgcgtactttgagtggatgccggtgcgggtgcgc
cccgaggcacgagcccagcacctctaccgcaccctgcagtacggcccgttgatggagatc
atcatcccggacctgcgctcctaccgcgatgcgcagctgatccagtccggtgaccacctg
ctggactctgacccggacttcatccgcgccgccggccgggaggggcgcaccatgatgggg
cgcagccagttcgagtggttcagcaatgccatcaagtcctctaccgcgaagtggcaggtt
attgcgaatgctgtgatgtttgcacccatgaccctgccggagagcctggacccgaagctg
cacacctggctcgtggagaagatcggcctgccggagcagggaatcccgctgaatcccgac
cagtgggacggttacatggcggaacggcagaagatcattgacatgatcgccgggctgccg
gataagaacgtggtcttcctgaccggggacatccacacctcttgggccagcgacattcca
agggacgtatttggctaccgcacaggccagaacacgaaggcggtcgccaccgagttcgta
accccgtctgtcactgcgaatagcgcattcgattctttggcggtcagccgcgccttcgac
gctgccacccgtcagctgctctatacgggggagaacctgctctccgggctcaaccggtgg
ttcaagtggatcaacttaacccaccacggctacatggctgtcgaggtcgggcaggaggcc
acgcagtgcgactggcacttcgtggaccacgtgctggccaaggacaccccattccgcctg
ggaaatagcttccgggccgaggtgggctccccgggtgcccgcagcgttgccgcggggctg
agtcgcgcccagcgggtttactga

DBGET integrated database retrieval system