KEGG   Corynebacterium urealyticum DSM 7109: cur_1698Help
Entry
cur_1698          CDS       T00685                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cur_1698
Enzymes [BR:cur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     cur_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1971265..1971933)
Genome map
AA seq 222 aa AA seqDB search
MASNTAGWRVAIGLGSNMPGDQGSPEAMIRAAASAVLDLPGTQLLAASQVYATPPWGVVT
QEEFRNAVILVATELEPLDLLHACQHIENEGGRVRLQHWGPRTVDLDLLAAYDAATGEPV
ISGGCWGEELILPHPYTTARGFVLVPWAEIAPEDPLPRVPGSPAGPAATATVGEWLAQLP
EEDTAGITQLGALLTSPATPGEAGVDVLKTTATSPGTATSPG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagcaacaccgccggctggcgggtggccatcgggctgggcagtaatatgcccggc
gaccagggcagcccggaagccatgatccgcgcggccgccagcgccgtgctcgatctgccc
ggcacccagctgctggcagcctcccaggtctacgccaccccgccgtggggcgtggtcacc
caggaagaattccgcaacgccgtgattctcgtggccaccgaactagagcccctcgatctg
ctgcacgcttgccagcacatcgagaacgaaggcggtcgggtgcgcctccagcactggggg
ccgcgcaccgtggacctcgacctgctggccgcctacgacgccgccaccggcgagccggtg
atctccggtgggtgctggggcgaggagctgatcctgccgcacccgtacaccaccgcccgg
ggattcgtgctcgtgccctgggcagagatcgccccggaggacccgctgccgcgcgtgccc
ggctccccggcagggccggccgcaaccgccacggtcggtgagtggctggcccagctgccc
gaagaggacaccgcaggcatcacccagctcggggcgctgctgaccagtccagccacgccc
ggggaggctggggttgacgtcctaaaaacgacagcaacgagcccagggaccgcgacgagc
cctgggtag

DBGET integrated database retrieval system