KEGG   Corynebacterium urealyticum DSM 7109: cur_1700Help
Entry
cur_1700          CDS       T00685                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cur_1700
Enzymes [BR:cur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     cur_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1972308..1973261)
Genome map
AA seq 317 aa AA seqDB search
MMQPAQSAQPDQPTTPEKSTQQNQSATPPRTKVMGILNVTEDSFSDGGSNPDTATAVRHA
QQMVDAGADIIDVGGESTRPGAQRVDPEIERGRVTPVIAELSALGITTSVDTMRAATALA
AAEAGVDILNDVSGGLADKDMLPVAAETGLPICLMHWLTDRFEGAEGYADQSAGTGVDVV
TAVRDWLLRRVDAALAAGVKEENIILDPGIGFAKSPADNWQLLGAMGQLNELGFPVLIGA
SRKRFLTALRPASDGLPGSPETADDATAAVSALAAQAGSWAVRVNNVAPSRAAVDVAYYS
RLGDGPAVAEGWRARRG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcctgcacagtctgctcagcctgaccagccgaccacgccggagaagagcacc
cagcagaaccagtcggccaccccgccgcgcaccaaggtgatggggatcctcaacgtcacg
gaagactccttctccgacgggggctccaacccggacaccgccaccgccgtgcgccatgcc
cagcagatggttgacgcgggcgcggacattatcgacgtcggcggcgaatccacccgcccc
ggcgcccagcgcgttgacccggaaatcgaacgcgggcgcgtgacccccgtgatcgcggag
ctctccgcgctgggtatcaccacgagcgtggacaccatgcgcgccgccaccgcactcgcc
gctgcggaggccggggtggacatcctcaacgacgtctccggtggcctcgcggacaaggac
atgctccccgtcgccgccgagaccggcctgccgatctgcctcatgcactggctgaccgac
cgcttcgaaggcgcggaaggctacgcggatcagagcgcgggcaccggcgtggatgtggtc
accgccgtccgcgactggctgctgcgccgagtggacgcagcactcgccgccggggtgaaa
gaggagaacatcatcctggatcccggcatcgggtttgcgaagtccccggcggataactgg
cagctcctgggggcgatgggccagctcaacgagctgggtttccccgtgctgatcggcgcc
agccgtaagcgtttcctcaccgccctgcgccctgccagcgacggcctccctggctccccg
gagacggcggacgacgccaccgcggcggtctccgcgctggcagcccaggcgggctcctgg
gcggtgcgggtgaacaacgtggccccctcccgggccgcggtggacgtggcttattactcc
cgcctgggcgacggcccggcggtggcagaagggtggcgagcgcgccgtggctga

DBGET integrated database retrieval system