KEGG   Corynebacterium urealyticum DSM 7109: cur_1829Help
Entry
cur_1829          CDS       T00685                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    cur_1829 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cur_1829 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    cur_1829 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    cur_1829 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cur_1829 (adhA)
   00626 Naphthalene degradation
    cur_1829 (adhA)
Enzymes [BR:cur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cur_1829 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2123289..2124317
Genome map
AA seq 342 aa AA seqDB search
MTDTTFRAAVVEDFGPELNLRDVEMPTPGRNQALVKLQASGICHTDLHAAEGDWPVKPEP
PFVPGHEGVGEVVELGPGDHSVKVGDIVGNVWLWSACGECEYCRTGWETLCNQAEYGGYT
VNGSFGTYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKVSETKPGQFMVISGVGG
LGHIAVQYAVAMGMRVIAVDIADEKLELAKKHGAEFTVNAKHADPAEAVQEFTDGGAHGV
LVTAVHPQAFGQAVGMARKGGTIVFNGLPPGDFPAPIFEIVFKALTIRGSLVGTRQDLAE
ALDFYARGLIKPTVSECSLDDVNAVFEELRHGKVDGRMSIRY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacaacgttccgcgccgccgtcgttgaggacttcggtcccgaactcaacctc
cgcgacgtcgagatgcccacgcccggccgcaaccaggcgctggtgaagctgcaggcctcc
ggcatctgccacaccgacctccatgccgccgagggtgactggcccgtcaagcccgagccg
cccttcgttcccggccacgagggtgtcggcgaggtcgtcgaactcggccccggtgaccac
tccgtcaaggtcggcgacatcgtcggcaacgtctggctctggtccgcctgcggtgagtgc
gagtactgccgcaccggatgggagaccctgtgcaaccaggccgagtacggcggctacacc
gtcaacggctccttcggcacctacatgctcgtggatacccgctactgcgcccgcatcccc
gagggctccgaccccgtcgaggtcgccccgatcctgtgcgccggcgtcaccgtctacaag
gggctgaaggtctccgagaccaagcccggtcagttcatggtcatctccggcgtcggcggc
ctcggccacatcgccgtccagtacgccgtggccatgggtatgcgcgtcatcgccgtcgac
atcgccgacgagaagctcgagctggccaagaagcacggcgcggagttcaccgtcaacgcc
aagcacgccgacccggccgaggcggtccaggagttcaccgacggcggcgcccacggtgtc
ctggtcaccgcggtccacccgcaggcgttcggccaggcggtcggcatggcccgcaagggc
ggcaccatcgtgttcaacggcctgcccccgggggacttcccggccccgatcttcgagatc
gtgttcaaggccctgaccatccgcggctccctcgtgggtacccgccaggacctggccgag
gcgctcgacttctacgcccgcggcctgatcaagccgaccgtgtccgagtgctccctcgac
gacgtcaacgccgtcttcgaggaactgcgccacggcaaggtcgacggccgcatgtccatc
cgctactag

DBGET integrated database retrieval system