KEGG   Corynebacterium urealyticum DSM 7109: cur_1835Help
Entry
cur_1835          CDS       T00685                                 

Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    cur_1835
   01230 Biosynthesis of amino acids
    cur_1835
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cur_1835
   00290 Valine, leucine and isoleucine biosynthesis
    cur_1835
Enzymes [BR:cur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     cur_1835
    2.6.1.66  valine---pyruvate transaminase
     cur_1835
Amino acid related enzymes [BR:cur01007]
 Aminotransferase (transaminase)
  Class I
   cur_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126973..2128217
Genome map
AA seq 414 aa AA seqDB search
MSKPLRPSELRHLNQSSKLANVLYEIRGPVNAEAERMAADGHRILKLNTGNPAEFGFEAP
DVIMRDMISALPHAQGYSTSKGIISARRAIVARYEVIPGFPEFDVEDVFLGNGVSELITM
TMQALLDDGDEVLIPSPDYPLWTASTSLSGGKPVHYLCDEEDNWNPSIEDIRSKVTERTK
AIVVINPNNPTGAVYSKEILQQIVDVAREHSLLILADEIYDKILYDDAKHINIASLCPDL
LCLTFNGLSKAYRVAGYRSGWMVITGPKGHAEGFLEGLTMLAGTRLCPNVPAQHAIQVAI
SGRQSIDGLVLPGGRLLEQRNMAWEKLNEIPGVSCVKPMGALYAFPKLDPNVHEIHDDEK
LMFDLLRAEKIHLVQGTGFNWPTPDHFRMVTLPWARDIKDAIERLGNFLASYRQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcccctacgccccagcgaattgcgccacctgaaccaatcttcgaagctggct
aacgttctctacgagatccgcggcccagtcaacgcggaagccgagcgcatggccgccgac
ggccaccggatcctcaagctgaacaccggcaaccccgccgagttcggcttcgaggccccg
gatgtgatcatgcgcgacatgatctccgctctgccgcacgcgcagggttactccacctcc
aagggcatcatctccgcccgccgcgcgatcgtcgcccgctacgaggtcatccccggcttc
ccggagttcgacgtcgaggacgtcttcctgggtaacggtgtctccgagctgatcacgatg
acgatgcaggccctgctcgacgacggcgacgaggtcctcatcccgtcccccgactacccg
ctgtggacggcgtcgacgtccctgtccggcggtaagccggtgcactacctgtgcgacgag
gaggacaactggaacccctccatcgaggacatccgctccaaggtcaccgagcgcaccaag
gccatcgtggtgatcaacccgaataacccgaccggcgcggtgtattccaaggagatcctg
cagcagatcgtggatgtggcccgcgagcattctctgctcatcctggccgacgagatctac
gacaagatcctgtacgacgacgccaagcacatcaacatcgcgagcctctgcccggacctg
ctgtgcctgaccttcaacggcctctccaaggcctaccgggtcgccggttaccgctccggc
tggatggtcatcaccggcccgaaggggcacgcggagggcttcctggagggcctgacgatg
ctcgccgggacgcggctgtgcccgaatgttccggcccagcacgccatccaggtggcgatc
tccggccgtcagtccatcgacggcctcgtgctgccaggtggccgtctgctggagcagcgc
aatatggcgtgggagaagctcaacgagatcccgggcgtgagctgcgtgaagccgatgggc
gcgctctacgctttcccgaagctggacccgaacgtccacgagatccacgacgatgaaaag
ctcatgttcgatctgctccgcgcggagaagattcacctggttcagggcacgggtttcaac
tggccgaccccggatcacttccgcatggttaccctgccgtgggcccgcgatatcaaggac
gccatcgagcggctggggaacttcctcgccagctaccgccagtag

DBGET integrated database retrieval system