KEGG   Corynebacterium urealyticum DSM 7109: cur_1835Help
Entry
cur_1835          CDS       T00685                                 

Definition
aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:cur01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cur01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cur00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:cur00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126973..2128217
Genome map
AA seq 414 aa AA seqDB search
MSKPLRPSELRHLNQSSKLANVLYEIRGPVNAEAERMAADGHRILKLNTGNPAEFGFEAP
DVIMRDMISALPHAQGYSTSKGIISARRAIVARYEVIPGFPEFDVEDVFLGNGVSELITM
TMQALLDDGDEVLIPSPDYPLWTASTSLSGGKPVHYLCDEEDNWNPSIEDIRSKVTERTK
AIVVINPNNPTGAVYSKEILQQIVDVAREHSLLILADEIYDKILYDDAKHINIASLCPDL
LCLTFNGLSKAYRVAGYRSGWMVITGPKGHAEGFLEGLTMLAGTRLCPNVPAQHAIQVAI
SGRQSIDGLVLPGGRLLEQRNMAWEKLNEIPGVSCVKPMGALYAFPKLDPNVHEIHDDEK
LMFDLLRAEKIHLVQGTGFNWPTPDHFRMVTLPWARDIKDAIERLGNFLASYRQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcccctacgccccagcgaattgcgccacctgaaccaatcttcgaagctggct
aacgttctctacgagatccgcggcccagtcaacgcggaagccgagcgcatggccgccgac
ggccaccggatcctcaagctgaacaccggcaaccccgccgagttcggcttcgaggccccg
gatgtgatcatgcgcgacatgatctccgctctgccgcacgcgcagggttactccacctcc
aagggcatcatctccgcccgccgcgcgatcgtcgcccgctacgaggtcatccccggcttc
ccggagttcgacgtcgaggacgtcttcctgggtaacggtgtctccgagctgatcacgatg
acgatgcaggccctgctcgacgacggcgacgaggtcctcatcccgtcccccgactacccg
ctgtggacggcgtcgacgtccctgtccggcggtaagccggtgcactacctgtgcgacgag
gaggacaactggaacccctccatcgaggacatccgctccaaggtcaccgagcgcaccaag
gccatcgtggtgatcaacccgaataacccgaccggcgcggtgtattccaaggagatcctg
cagcagatcgtggatgtggcccgcgagcattctctgctcatcctggccgacgagatctac
gacaagatcctgtacgacgacgccaagcacatcaacatcgcgagcctctgcccggacctg
ctgtgcctgaccttcaacggcctctccaaggcctaccgggtcgccggttaccgctccggc
tggatggtcatcaccggcccgaaggggcacgcggagggcttcctggagggcctgacgatg
ctcgccgggacgcggctgtgcccgaatgttccggcccagcacgccatccaggtggcgatc
tccggccgtcagtccatcgacggcctcgtgctgccaggtggccgtctgctggagcagcgc
aatatggcgtgggagaagctcaacgagatcccgggcgtgagctgcgtgaagccgatgggc
gcgctctacgctttcccgaagctggacccgaacgtccacgagatccacgacgatgaaaag
ctcatgttcgatctgctccgcgcggagaagattcacctggttcagggcacgggtttcaac
tggccgaccccggatcacttccgcatggttaccctgccgtgggcccgcgatatcaaggac
gccatcgagcggctggggaacttcctcgccagctaccgccagtag

DBGET integrated database retrieval system