KEGG   Corynebacterium urealyticum DSM 7109: cur_1911Help
Entry
cur_1911          CDS       T00685                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    cur_1911 (recR)
DNA repair and recombination proteins [BR:cur03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      cur_1911 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2227778..2228599)
Genome map
AA seq 273 aa AA seqDB search
MFEGPLQDVIDEFASLPGIGPKSAQRIALHLLENATGEDIERFQATLGNLHSGVAFCRIC
HNISQEDVCRICADSSRDASLVCVVEEPKDIQVIERTGEYRGRYHVLGGALDPLNGVGPG
ELNVTALVQRIGGVLPDVAVSAPHASAGGPVQGSLMDGGAGAGTGGGSGAGAGGAGVGSD
GLGAGAGSEATGNERGADEVEYREAPEITEVIIATDPNTEGEATASYLGRLLKEFPGLTV
SRLASGIPMGGDLEFVDELTLSRAFAGRTQLKL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaaggtccgcttcaggacgtcatcgacgagttcgccagcctcccaggcatcggg
ccgaaaagcgcgcagcgcatcgccctccacctgctggaaaacgcgaccggcgaggacatc
gaacgtttccaagccacgctggggaatttgcactccggcgtggcgttttgccgtatctgc
cacaacatctcccaggaggacgtctgccgcatctgcgcggattcttccagggacgccagc
ctggtgtgcgtggtcgaggagccgaaggacattcaggtcatcgagcgcaccggtgagtac
cggggcaggtaccacgtgctcggtggggcgctggacccgctgaatggcgtggggccgggg
gagctgaacgtgaccgcgctcgtgcagcggatcggtggggtgctgccggatgtggcggtg
agcgcgccgcacgcgtcggccggtgggccggtgcaggggtcgctgatggacggcggcgct
ggcgcgggcacaggtggtggcagcggtgctggtgctggtggcgctggagtaggcagcgac
ggcttgggtgcgggtgctggcagcgaggccacgggcaatgaacgcggtgccgacgaggtt
gagtaccgcgaggccccggagatcaccgaggtcatcatcgccaccgacccgaacactgag
ggcgaggccactgcctcctacctggggcgtttgctgaaggagttcccggggctgacggtc
tcgcgcctggccagcgggatccccatgggtggggacctggagttcgtggacgagctcacg
ctctcccgcgcgttcgcgggccgtacccagctgaagctctag

DBGET integrated database retrieval system