KEGG   Corynebacterium variabile: CVAR_0103Help
Entry
CVAR_0103         CDS       T01594                                 

Gene name
deoA
Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cva  Corynebacterium variabile
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CVAR_0103 (deoA)
Enzymes [BR:cva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CVAR_0103 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125260..126564
Genome map
AA seq 434 aa AA seqDB search
MTTPDHHPEPFDAVDIIAAKRDRHRLADAQIDWVIDAYTRGVVAEEQMAALAMAVYLNDL
DRAETARWTTAMVSSGTRLNFDDLGKPTADKHSTGGVGDKITLALTPLVASYGVAVPQLS
GRGLGHTGGTLDKLESIPGWQAQISTQRMREIMRDVGGVVCAAGEDLAPADRRLYALRDV
TGTVDCIPLIASSVMSKKIAEGTGALVLDVKVGSGAFMKDRESARLLASTMVEIGQDAGV
TTTALLTDMFRPLGRTVGNALEVREAVEVLAGGGPEDVVELTVALAREMLTAVRVDADPA
DALCDGRAMDSWRAMVTAQGGDPDSDLPTATHTHEVTADRDGWLTHTDALAFGVASWRLG
AGRARKEDPVQAGAGIELHTVVGERVRAGQPLFSLHTDDPARFDRALASLEDAWTVTGEE
PEPRESVVLERIGD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccgaccatcacccggagcccttcgacgccgtcgacatcatcgccgccaag
cgtgaccgccaccggctcgccgacgcgcagatcgactgggtcatcgacgcgtacacccgt
ggcgtcgtcgccgaggagcagatggcggcactggccatggcggtctacctcaacgacctg
gaccgggcggagaccgcccgctggaccaccgccatggtgagctccggcacccggctgaac
ttcgatgacctgggtaagcccaccgcagacaagcactccaccggtggcgtcggcgacaag
atcaccctcgcgctcacgccgctcgtggcgtcctacggggtggcggtaccgcagctgtcc
gggcgcggtctcggtcataccggcggcaccctcgacaagctggagtcgatcccaggctgg
caggcgcagatcagcacacaacggatgcgggagatcatgcgtgatgtcggcggcgtggtc
tgcgcggcgggggaggacctcgccccggctgaccgacggctctacgccctgcgcgacgtc
accggcaccgtcgactgcatcccgctcatcgcgtcctcggtcatgagcaagaagatcgcc
gagggcaccggcgcgctggtcctcgatgtgaaggtcggctccggtgcgttcatgaaggat
cgggagagcgcccgcctgctcgcctccacgatggtggagatcgggcaggacgccggggtc
acgaccaccgcgctgctcaccgacatgttccggccgctgggccgcaccgtcggcaatgcc
ctggaggtccgtgaggccgtcgaggtgctcgccggtggtgggccggaggatgtggtggag
ctgaccgtggcgctggcgcgggagatgctcactgccgtgcgcgtggacgctgacccggcc
gacgcactgtgtgacggtcgggccatggactcctggcgggccatggtcaccgcccagggc
ggggatccggactccgacctgcccaccgccacgcacacccacgaggtcactgctgaccgg
gacgggtggctgactcacaccgatgcactggcattcggggtggcgtcctggcgactcggg
gcgggccgggcgcgcaaggaggacccggtgcaggccggggcgggtatcgagctgcacact
gtggtgggcgagcgggtccgcgccgggcagcccctgttctcgctgcacaccgacgatccc
gcccggttcgaccgggcactggcgtccctcgaggacgcctggacggtcaccggtgaagaa
ccggaaccccgggaatccgtggtcctggagagaatcggcgactga

DBGET integrated database retrieval system