KEGG   Corynebacterium variabile: CVAR_0155Help
Entry
CVAR_0155         CDS       T01594                                 

Gene name
adhA1
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CVAR_0155 (adhA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_0155 (adhA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_0155 (adhA1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CVAR_0155 (adhA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CVAR_0155 (adhA1)
   00626 Naphthalene degradation
    CVAR_0155 (adhA1)
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CVAR_0155 (adhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(184805..185830)
Genome map
AA seq 341 aa AA seqDB search
MTDTFTGAVVEEFGAPVVVKDVELPTPGHNQALVKLIASGICHTDLHAAHGDWPVKPEPP
FIPGHEGVGEVVELGPGDHTVKVGDIVGNAWLWSACGNCDQCLKGWETLCPNAEYGGYTV
DGSFGTYMLVDTRFAPKIPEGADPLEVAPILCAGVTVYKGLKVSETKPGQFMVISGVGGL
GHLAVQYAKSMGMRVIAVDIADEKLALAKKHGAEITVNAAEVDPAEAVQEYTDGGAHGIL
VTAVHPQAFGQAINMARRAGTIVFNGLPPGEFPAPIFDIVLKGLTIRGSLVGDRQDQVEA
LDFYARGLIHPTVTECRLDDVNEVFTNMEKGKIDGRMAIRY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgttcaccggagctgtcgtcgaggagttcggcgcccccgtcgtcgtcaag
gacgtcgaactgcccactcccggacacaaccaggctctcgtcaagctcatcgcctccggc
atctgccacaccgacctccacgccgcccacggcgactggccggtcaagcccgagcccccg
ttcattcccggccacgaaggagtcggtgaggtcgtcgagctcggacccggcgaccacacc
gtgaaggtcggcgacatcgtcggcaacgcctggctctggtccgcctgcgggaactgtgac
cagtgcctgaagggctgggagacgctctgccccaacgcggagtacggcggatacaccgtc
gacggttccttcggcacctacatgctcgtcgacacccgcttcgccccgaagatcccggaa
ggcgctgacccgctggaggtcgccccgatcctctgcgccggtgtcaccgtctacaagggc
ctcaaggtctccgagacgaagcccggccagttcatggtcatctccggtgtcggtggtctc
ggtcacctcgccgtgcagtacgccaagtccatgggcatgcgcgtcatcgccgtcgatatc
gccgatgagaagctggcgctggcgaagaagcacggtgcggagatcaccgtcaacgccgcc
gaggtcgacccggccgaggccgtgcaggagtacaccgacggcggtgcccacggcatcctc
gtcactgcggtgcaccctcaggcgttcggccaggcgatcaacatggcccgccgcgccggc
accatcgtcttcaacggcctgcccccgggagagttccccgccccgatcttcgacatcgtg
ctcaagggtctgacgatccgcggctcgctcgtcggtgaccgccaggaccaggtcgaggcg
ctggacttctatgcccgtggcctcatccacccgacggtgaccgagtgccgcctcgatgac
gtcaacgaggtcttcaccaacatggagaagggcaagatcgacggacgtatggcgatccgc
tactga

DBGET integrated database retrieval system