KEGG   Corynebacterium variabile: CVAR_0287Help
Entry
CVAR_0287         CDS       T01594                                 

Gene name
fadB1
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cva  Corynebacterium variabile
Pathway
cva00071  Fatty acid degradation
cva00280  Valine, leucine and isoleucine degradation
cva00281  Geraniol degradation
cva00310  Lysine degradation
cva00362  Benzoate degradation
cva00380  Tryptophan metabolism
cva00410  beta-Alanine metabolism
cva00640  Propanoate metabolism
cva00650  Butanoate metabolism
cva00903  Limonene and pinene degradation
cva00930  Caprolactam degradation
cva01040  Biosynthesis of unsaturated fatty acids
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
cva01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CVAR_0287 (fadB1)
   00650 Butanoate metabolism
    CVAR_0287 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_0287 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    CVAR_0287 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVAR_0287 (fadB1)
   00310 Lysine degradation
    CVAR_0287 (fadB1)
   00380 Tryptophan metabolism
    CVAR_0287 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVAR_0287 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CVAR_0287 (fadB1)
   00281 Geraniol degradation
    CVAR_0287 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVAR_0287 (fadB1)
   00930 Caprolactam degradation
    CVAR_0287 (fadB1)
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CVAR_0287 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CVAR_0287 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CVAR_0287 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 UDPG_MGDP_dh_N DAO NAD_binding_8 F420_oxidored adh_short_C2 2-Hacid_dh_C NAD_Gly3P_dh_N Sacchrp_dh_NADP Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEK35635
UniProt: G0HCR0
Position
complement(344354..346645)
Genome map
AA seq 763 aa AA seqDB search
MSENIISWDADANGVVTLTIDDPSAPVNVMNDAFRDSLAETVAKLQAAVEAKEISGVVIT
SAKKTFFAGGDIKSMITAGPAEAEATRDMCDGMKANFRALETLGVPVVAAVNGAALGGGL
EVALATHHRIASDAKGLKVGLPEVTLGLLPGGGGVTRVTRLLGLATALTKVLTTGKQFNA
EAAKEIGLIDEVVPADQLVDAAKAWIAENPDATQPWDRKGFKIPGGTPSTPALAAMLPSF
PANVTKQVKGAPMPAPKAILAAAVEGAQLKRIEDATAVETRYFVELVTGPTSTNMMQAFF
FDLNHCNGGGSRPLQADGTPFPKTTFRKIGVIGAGMMGAGIAYVAAKSGIEVVLKDISEE
NAARGKAYSEGLEAKALKRGRTTEEKSAELLARIKPSADYADLADVDLVVEAVFENTELK
HKVFAEIEAAVPGTAVLGSNTSTLPITGLAEGVDRKGDFIGLHFFSPVDKMPLIEIISGA
ETSPETLAKGLDFARQIRKTPIVVNDSRGFYTSRVIGTVLNEAMRMLVEGVDPAVIESAG
RQAGYPAPQLQLQDELNLKLARKIGAETKAAADAAGVSVDDGGVNALVDVMLDTFERPGK
LEGKGFYEYDENGRRAGLWSGLRGELAEKLGITPVTVPDGEAATDGHGLDSTVSAGEAGP
SLNDLVERMLFIEAIETQKCVDEGVLTSDADANIGSILGIGYPAWTGGTRQFITNYARPA
AATLPEDAAADYPTAGVAGFVARAEELAATYGERFTPVASLKG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacatcatcagttgggacgcagacgccaacggtgtggtcaccctgaccatc
gacgacccgtccgcccccgtcaacgtcatgaacgacgccttccgcgactccctcgcggag
actgtggccaagctgcaggccgcggtcgaggccaaggaaatctccggtgtcgtcatcacc
tccgcgaagaagaccttcttcgccggcggcgacatcaagtccatgatcaccgccggcccg
gccgaggccgaggccacccgtgacatgtgcgacggcatgaaggccaacttccgcgccctc
gagacactcggcgtcccggtcgtcgccgcggtcaacggtgccgccctcggcggtggcctc
gaggtcgccctggccacccaccaccgcatcgcctccgacgccaagggcctgaaggtcggc
ctccccgaggtcaccctggggctgctgcccggtggcggcggcgtcacccgcgtcacccgc
ctgctcggcctggccacagccctgaccaaggtcctgaccaccggcaagcagttcaacgcc
gaggctgccaaggagatcggcctcatcgacgaggtcgtccccgccgaccagctggtcgac
gccgccaaggcctggatcgccgagaacccggatgctacccagccgtgggaccgcaagggc
ttcaagatccccggcggcaccccgtccaccccggcgctcgccgcgatgctccccagcttc
ccggccaacgtcaccaagcaggtcaagggcgccccgatgcccgccccgaaggcgatcctc
gccgccgccgtcgagggtgcgcagctcaagcgtatcgaggacgccacggccgtcgagacc
cgctacttcgtcgagctggtcaccggcccgacctcgacgaacatgatgcaggccttcttc
ttcgacctgaaccactgcaacggcggcggctcccgcccgctgcaggctgacggcaccccg
ttcccgaagaccaccttcaggaagatcggcgtcatcggcgccggcatgatgggcgcgggc
atcgcctacgtcgccgcgaagtccggtatcgaggtcgtcctcaaggacatctccgaggag
aacgccgcccgtggcaaggcctactccgagggcctggaggccaaggcgctcaagcgcggc
cgcaccaccgaggagaagtccgccgagctgctggcccgcatcaagccctccgccgactac
gccgacctggccgacgtcgacctggtcgtcgaggccgtcttcgagaacaccgagctcaag
cacaaggtcttcgccgagatcgaggccgccgtgccgggcaccgccgtcctgggttccaac
acctccaccctgccgatcaccggcctggccgagggcgtggaccgcaagggcgacttcatc
ggtctgcacttcttctccccggtcgacaagatgccgctcatcgagatcatctccggcgcc
gagacctccccggagaccctggccaagggcctcgacttcgcccgccagatccgcaagacc
ccgatcgtcgtcaacgactcccgcggtttctacacctcgcgtgtcatcggcaccgtcctc
aacgaggcaatgcgcatgcttgtcgagggtgtcgacccggccgtcatcgagtccgcgggc
cgccaggccggttaccccgccccgcagctccagctgcaggacgagctgaacctcaagctg
gcccgcaagatcggtgccgagaccaaggccgccgccgacgccgcgggtgtctccgtcgac
gacggtggcgtcaacgccctggtggacgtcatgctcgacaccttcgagcgtcctggcaag
ctcgagggcaagggcttctacgagtacgacgagaacggtcgccgcgccggcctgtggtcc
ggtctgcgtggtgagctcgccgagaagctcggtatcaccccggtcaccgtgcccgacggc
gaggccgcgaccgacggtcacggtctggattccaccgtctccgccggcgaggccggcccg
agcctcaacgacctcgtcgagcgcatgctcttcatcgaggccatcgagacccagaagtgt
gtcgacgagggcgtgctgacctccgatgcggacgccaacatcggctccatcctcggtatc
ggctacccggcgtggaccggcggcacccgccagttcatcaccaactacgcccgcccggcc
gccgccacactgcctgaggacgccgcggccgactacccgaccgccggtgtcgccggcttc
gtcgcccgcgccgaggaactcgccgccacctacggtgagcgattcaccccggtcgcgtcg
ctgaagggttag

DBGET integrated database retrieval system