KEGG   Corynebacterium variabile: CVAR_0287Help
Entry
CVAR_0287         CDS       T01594                                 

Gene name
fadB1
Definition
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cva  Corynebacterium variabile
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_0287 (fadB1)
   01212 Fatty acid metabolism
    CVAR_0287 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CVAR_0287 (fadB1)
   00650 Butanoate metabolism
    CVAR_0287 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_0287 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    CVAR_0287 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVAR_0287 (fadB1)
   00310 Lysine degradation
    CVAR_0287 (fadB1)
   00380 Tryptophan metabolism
    CVAR_0287 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVAR_0287 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CVAR_0287 (fadB1)
   00281 Geraniol degradation
    CVAR_0287 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CVAR_0287 (fadB1)
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CVAR_0287 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CVAR_0287 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CVAR_0287 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(344354..346645)
Genome map
AA seq 763 aa AA seqDB search
MSENIISWDADANGVVTLTIDDPSAPVNVMNDAFRDSLAETVAKLQAAVEAKEISGVVIT
SAKKTFFAGGDIKSMITAGPAEAEATRDMCDGMKANFRALETLGVPVVAAVNGAALGGGL
EVALATHHRIASDAKGLKVGLPEVTLGLLPGGGGVTRVTRLLGLATALTKVLTTGKQFNA
EAAKEIGLIDEVVPADQLVDAAKAWIAENPDATQPWDRKGFKIPGGTPSTPALAAMLPSF
PANVTKQVKGAPMPAPKAILAAAVEGAQLKRIEDATAVETRYFVELVTGPTSTNMMQAFF
FDLNHCNGGGSRPLQADGTPFPKTTFRKIGVIGAGMMGAGIAYVAAKSGIEVVLKDISEE
NAARGKAYSEGLEAKALKRGRTTEEKSAELLARIKPSADYADLADVDLVVEAVFENTELK
HKVFAEIEAAVPGTAVLGSNTSTLPITGLAEGVDRKGDFIGLHFFSPVDKMPLIEIISGA
ETSPETLAKGLDFARQIRKTPIVVNDSRGFYTSRVIGTVLNEAMRMLVEGVDPAVIESAG
RQAGYPAPQLQLQDELNLKLARKIGAETKAAADAAGVSVDDGGVNALVDVMLDTFERPGK
LEGKGFYEYDENGRRAGLWSGLRGELAEKLGITPVTVPDGEAATDGHGLDSTVSAGEAGP
SLNDLVERMLFIEAIETQKCVDEGVLTSDADANIGSILGIGYPAWTGGTRQFITNYARPA
AATLPEDAAADYPTAGVAGFVARAEELAATYGERFTPVASLKG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacatcatcagttgggacgcagacgccaacggtgtggtcaccctgaccatc
gacgacccgtccgcccccgtcaacgtcatgaacgacgccttccgcgactccctcgcggag
actgtggccaagctgcaggccgcggtcgaggccaaggaaatctccggtgtcgtcatcacc
tccgcgaagaagaccttcttcgccggcggcgacatcaagtccatgatcaccgccggcccg
gccgaggccgaggccacccgtgacatgtgcgacggcatgaaggccaacttccgcgccctc
gagacactcggcgtcccggtcgtcgccgcggtcaacggtgccgccctcggcggtggcctc
gaggtcgccctggccacccaccaccgcatcgcctccgacgccaagggcctgaaggtcggc
ctccccgaggtcaccctggggctgctgcccggtggcggcggcgtcacccgcgtcacccgc
ctgctcggcctggccacagccctgaccaaggtcctgaccaccggcaagcagttcaacgcc
gaggctgccaaggagatcggcctcatcgacgaggtcgtccccgccgaccagctggtcgac
gccgccaaggcctggatcgccgagaacccggatgctacccagccgtgggaccgcaagggc
ttcaagatccccggcggcaccccgtccaccccggcgctcgccgcgatgctccccagcttc
ccggccaacgtcaccaagcaggtcaagggcgccccgatgcccgccccgaaggcgatcctc
gccgccgccgtcgagggtgcgcagctcaagcgtatcgaggacgccacggccgtcgagacc
cgctacttcgtcgagctggtcaccggcccgacctcgacgaacatgatgcaggccttcttc
ttcgacctgaaccactgcaacggcggcggctcccgcccgctgcaggctgacggcaccccg
ttcccgaagaccaccttcaggaagatcggcgtcatcggcgccggcatgatgggcgcgggc
atcgcctacgtcgccgcgaagtccggtatcgaggtcgtcctcaaggacatctccgaggag
aacgccgcccgtggcaaggcctactccgagggcctggaggccaaggcgctcaagcgcggc
cgcaccaccgaggagaagtccgccgagctgctggcccgcatcaagccctccgccgactac
gccgacctggccgacgtcgacctggtcgtcgaggccgtcttcgagaacaccgagctcaag
cacaaggtcttcgccgagatcgaggccgccgtgccgggcaccgccgtcctgggttccaac
acctccaccctgccgatcaccggcctggccgagggcgtggaccgcaagggcgacttcatc
ggtctgcacttcttctccccggtcgacaagatgccgctcatcgagatcatctccggcgcc
gagacctccccggagaccctggccaagggcctcgacttcgcccgccagatccgcaagacc
ccgatcgtcgtcaacgactcccgcggtttctacacctcgcgtgtcatcggcaccgtcctc
aacgaggcaatgcgcatgcttgtcgagggtgtcgacccggccgtcatcgagtccgcgggc
cgccaggccggttaccccgccccgcagctccagctgcaggacgagctgaacctcaagctg
gcccgcaagatcggtgccgagaccaaggccgccgccgacgccgcgggtgtctccgtcgac
gacggtggcgtcaacgccctggtggacgtcatgctcgacaccttcgagcgtcctggcaag
ctcgagggcaagggcttctacgagtacgacgagaacggtcgccgcgccggcctgtggtcc
ggtctgcgtggtgagctcgccgagaagctcggtatcaccccggtcaccgtgcccgacggc
gaggccgcgaccgacggtcacggtctggattccaccgtctccgccggcgaggccggcccg
agcctcaacgacctcgtcgagcgcatgctcttcatcgaggccatcgagacccagaagtgt
gtcgacgagggcgtgctgacctccgatgcggacgccaacatcggctccatcctcggtatc
ggctacccggcgtggaccggcggcacccgccagttcatcaccaactacgcccgcccggcc
gccgccacactgcctgaggacgccgcggccgactacccgaccgccggtgtcgccggcttc
gtcgcccgcgccgaggaactcgccgccacctacggtgagcgattcaccccggtcgcgtcg
ctgaagggttag

DBGET integrated database retrieval system