KEGG   Corynebacterium variabile: CVAR_0301Help
Entry
CVAR_0301         CDS       T01594                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cva  Corynebacterium variabile
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CVAR_0301
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CVAR_0301
Enzymes [BR:cva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CVAR_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364575..365915
Genome map
AA seq 446 aa AA seqDB search
MSLLMHTSVVPPRTVGRMNARRYTRTTTRSRTTAVALLAVTATLSGSLLGACSTDSSDSS
DSTDSGTSVATSAAESSETTPGTAPAEQPVSCVGEIDPADSEAVRRAAASTLSVGVTGFD
DAATAVDAGVRHIFIGSTTDQSLLNGQGDPARSLAALQERAGGDLTVSVDEEGGQVQRLA
DLTGPLPSAREMTATMAPAEVTDLFTDHARKLRDLGITVDFAPDVDLDGGEAVSDNAIGD
RAFSTDPAVVVEYGRAVIDGLLAGGVTPVIKHFPGHGHATGDSHLGTVTTPPIDQMGPDL
QPFAELAQIPGVAVMVGHMQVPGFDVEGVNGAETPASLNPASYGLLRSGVNDAPGFDGVI
YTDDLTGMHAITDHFSPGDAVVTALRAGADAPLVSSGMDAAAVSGVLDAVVAGVADGSLD
LGVVTTAADRICASGPATGVPEPVNG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctgctcatgcacacgagcgtagtcccaccacgtaccgtcgggaggatgaacgcc
cgaaggtacacccgcaccaccacccgcagccgcaccaccgctgtcgcactcctggcggtg
accgccaccctctccgggagcctcctcggtgcctgttcgaccgactcctccgactcctcc
gattccacggactccggcacctccgtcgccacgtccgcggcagagagttcggagaccacg
ccgggtaccgcgcccgccgaacagcccgtctcctgcgtcggtgagatcgaccccgcggac
agcgaggcggtacgccgggcggcggcatccaccctctctgtcggtgtgaccggattcgac
gacgccgctaccgccgtcgacgccggtgtccgccacatcttcatcggttccaccaccgac
cagtcgctcctcaacggccagggcgaccccgcccgttcgctcgccgccctgcaggaacgg
gccggcggcgacctcaccgtctccgtcgacgaggagggcggtcaggtccaacggctcgcc
gacctcaccggcccgctgccctccgcccgggagatgacggcgaccatggcccccgccgag
gtcaccgacctgttcaccgaccacgcccgcaagctccgcgacctcggcatcaccgtggac
ttcgcgccggacgtcgacctcgacggtggcgaggcggtcagcgacaacgccatcggggac
cgcgccttctccaccgaccccgccgtcgtggtggagtacggacgggcggtcatcgacggg
ctgctcgccgggggcgtcaccccggtgatcaagcacttccccggccacggccacgccacc
ggggattcccacctcggcaccgtcaccaccccgccgatcgaccagatgggtccggacctg
cagcccttcgccgaactggcgcagatccccggggtcgcggtgatggtcgggcacatgcag
gtccccggcttcgacgtcgagggtgtcaacggtgctgagacgccggcctcgctgaatccg
gcgtcctacgggctgctgcgcagcggggtcaatgacgcgccgggcttcgacggcgtcatc
tacaccgacgacctcaccggcatgcacgcgatcaccgaccacttcagccccggggatgcc
gtggtcaccgccctgcgtgccggggcggacgccccgctcgtgtcctccgggatggacgca
gcggccgtatccggcgtcctcgatgccgtcgtcgcgggagtcgccgacggatcacttgac
ctcggtgtggtgacgacggcggcggaccggatctgcgcttcgggaccggcaacgggcgta
ccggagcctgtgaacggttaa

DBGET integrated database retrieval system