KEGG   Corynebacterium variabile: CVAR_0642Help
Entry
CVAR_0642         CDS       T01594                                 

Definition
hypothetical protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cva  Corynebacterium variabile
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CVAR_0642
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CVAR_0642
   00650 Butanoate metabolism
    CVAR_0642
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_0642
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVAR_0642
   00310 Lysine degradation
    CVAR_0642
   00360 Phenylalanine metabolism
    CVAR_0642
   00380 Tryptophan metabolism
    CVAR_0642
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVAR_0642
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CVAR_0642
   00281 Geraniol degradation
    CVAR_0642
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVAR_0642
   00627 Aminobenzoate degradation
    CVAR_0642
   00930 Caprolactam degradation
    CVAR_0642
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CVAR_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750437..751177
Genome map
AA seq 246 aa AA seqDB search
MVGMTENAVSLEIDGRVAVVTLTRPDRRNALDAEVCTQLTAALEDATSRGGIRAILLRGE
GPAFCAGANLKGGVYADNFFAALEKMLTTVTDVPVPVIADIQGPAVGAGCQLALACDLRV
MGEGAVTWVPAVQHGFALDPWTVNRAVELLGGTHARNMLVAGAKVDRDAALTCGFAIQPG
TSEEALAFAHRVSEHAPLSTAWFKKALNHPEAPELADEARACWASRDVQEARTARADRRA
PVFEGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcatgacagagaacgcggtgtcgctggagatcgacgggcgggtggcggtggtc
accctgacccgaccggaccgcagaaatgcgctggacgccgaggtgtgcacgcagctcacc
gcagcactggaggacgccacctcccgcggcggcatccgcgccatcctgctgcgtggtgaa
ggcccggctttctgtgccggggcgaacctcaaaggcggggtctacgccgacaacttcttc
gccgcgttggagaagatgctgaccacggtcaccgatgttccggtgccggtcatcgcggat
atccagggccccgcggtcggcgcgggctgccagctcgccctggcctgtgacctgcgtgtc
atgggggagggcgccgtcacctgggtccccgccgtgcagcacggcttcgccctggatccg
tggaccgtgaaccgcgccgtggagttgctcggcggcacccatgcccgcaatatgctcgtc
gccggggcgaaggtcgaccgggatgccgcactgacctgtggcttcgccattcagccgggc
acctccgaggaggccctggccttcgcgcaccgtgtcagtgaacacgccccgctgtcgacc
gcctggttcaagaaggcgctcaatcatcccgaggccccggagctcgcggatgaggccaga
gcctgctgggccagccgcgatgtccaggaggcgcgcaccgcccgggcggaccgccgggcc
ccggtcttcgaggggcggtag

DBGET integrated database retrieval system