KEGG   Corynebacterium variabile: CVAR_0791Help
Entry
CVAR_0791         CDS       T01594                                 

Gene name
adhA2
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CVAR_0791 (adhA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_0791 (adhA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_0791 (adhA2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CVAR_0791 (adhA2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CVAR_0791 (adhA2)
   00626 Naphthalene degradation
    CVAR_0791 (adhA2)
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CVAR_0791 (adhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928081..929199
Genome map
AA seq 372 aa AA seqDB search
MTTHTTRDATIPTTMRAWQVTTPGPVDGDTPPLELVEKPVPGPGPGELLVHVHTCGVCRT
DLHVTEGDLDVHREHVIPGHEIVGDVVAVGEAVASSWEGARVGVAWLRSTCGECRWCRAG
TENLCPHSTYTGWDADGGYAEYTTVRADFAYRLPETGSDGTGEDAASGAASEVASDTALS
PLLCAGIIGYHALQRAGLPESTPEQPARLGLYGFGGSAHLCVQLALASGARVHVLTRDKA
AQDLALSLGCASAAGAYDMPPEPLDAAVLFAPVGDIVPVALRALDRGGVLSIAGIHLSDT
PPLNYENELFYEKEIRSVTSNTRAQGREFLSLVEEHGVRATTHEYPMSRGLDALRDLKAG
RFDGAAVLVNDF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacacaccacacgcgacgccacgatccccaccaccatgcgtgcctggcaggtc
accactccgggccccgtcgacggagacactccgccactggaactcgtcgaaaagccggta
cccgggccagggccgggggagttgctcgtccacgtccacacctgcggggtgtgccgcact
gacctgcacgtcaccgagggcgacctcgacgtccaccgggagcatgtcatccccggccac
gagatcgtcggtgacgttgtggcggtcggtgaggcggtggcgtcctcctgggagggcgcg
agggtcggcgtcgcctggctgcgctcgacctgcggggagtgccgctggtgccgcgcgggc
acggaaaacctctgcccgcactcgacctacaccggctgggacgccgacggcggctacgcg
gagtacaccacggtgcgcgccgacttcgcctaccggctgccggagaccggttccgacggg
acaggggaggacgccgcgtccggggcggcgtctgaagtggcgtccgacacagcgctgtca
cccctgctctgcgccgggatcatcggctaccacgccctgcagcgcgccgggctccccgaa
tccaccccggaacagccggcccggctggggctctacggtttcggcgggtcggcccacctg
tgcgtccagctggccctggcctctggtgcccgcgtccacgtcctgaccagggacaaggcc
gcgcaggacctggcgctgtcgttgggctgcgcctcggcggccggtgcctatgacatgccg
ccggagccgttggacgccgcggtgctcttcgccccggtgggtgacatcgtcccggtcgcg
ctgcgtgcgctggaccgaggtggtgtcctgtcgatcgccgggatccacctctcggacacc
ccgccgttgaactacgagaacgagctcttctacgagaaggagatccgctcggtcacctcg
aacacgagggcccagggccgcgagttcctgtcactggtggaggagcacggggtgcgcgcg
acgacgcacgagtacccgatgtcgcgggggctggacgcgctgcgcgaccttaaggcagga
cgcttcgacggggccgcggtgctggtcaatgacttctga

DBGET integrated database retrieval system