KEGG   Corynebacterium variabile: CVAR_0925Help
Entry
CVAR_0925         CDS       T01594                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cva  Corynebacterium variabile
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cva01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cva00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049717..1051009
Genome map
AA seq 430 aa AA seqDB search
MSDTDVQPDPSDPFFANPVFGTDNIHQPGPVIPATAKEFPDPDLSLDDPEYGHRSTARRT
IRDAKRVVVKIGSSSLTDETGSVSPERIDLIADALEARMDRGTDIIVVSSGSIACGMGPL
GLSQRPTDLATKQAAAAAGQVLLAQEWARSFARYGRPIGQVLLTVADASRRDRARNSQRT
IDRLRQLGIVPIVNENDTVTTSSATFGDNDRLASLVSHLTYADACVLLSDVAGLYDRNPA
EPDAKFIAEVRSHRDLRGVIAGDGGRLGTGGMSAKVSAARLASQGGIPVLLTSTDNIGAA
LDQAMVGTCFWPAEDRLSAWKFWILYAAEAGGVLHIDGGAAQAMEHHNSLLPVGITKITG
DFTSREVVDIVGPGGHLIGRGEVNYDAATLAGLMGKSSDELPDFAQRPAVHVDNLSTYAN
RLSRDYGATR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgacgtgcagcctgacccttccgaccctttcttcgcgaaccctgtgttc
gggacagataacatccatcagccaggaccggtcattccggcgacggcgaaggagttccct
gatcccgacctctctctcgacgatcccgagtacgggcaccggtcgaccgcgagacggacg
atccgtgacgccaagcgtgtcgtcgtgaagatcggctcctccagtctcaccgacgagaca
gggagtgtgagccccgaacgtatcgacctcattgccgacgccctggaagcccgcatggac
cgcgggaccgacatcatcgtcgtctcctccggctccatcgcctgcggcatgggaccgctc
ggcctgagccagcgacccaccgacctcgccaccaagcaggccgccgcggccgcgggacag
gtcctgctggcccaggagtgggcacgcagtttcgcccgctacggccggcccatcggccag
gtgctcctcactgtcgccgatgcatcgcgccgtgaccgcgcgagaaactcccagcggacc
atcgaccgactgagacagctcggcatcgtcccgatcgtcaacgagaacgacaccgtcacg
acctcctccgccaccttcggcgacaacgaccgtctcgcctccctggtgagccacctgacc
tacgcggatgcctgcgtactgctctccgatgtcgccggcctctacgaccgcaaccccgcc
gagccggacgccaagtttatcgccgaggtccgctcccacagagacctgcgtggcgtcatc
gccggtgacggcggacgcctgggcaccggaggcatgagtgcgaaggtctcggccgcgcgc
ctggcgtcccagggcggcatcccggtgctgctgacctccaccgacaacatcggtgccgcg
ctcgaccaggccatggtcggcacctgcttctggcccgccgaggaccgcctgtcggcgtgg
aagttctggatcctctacgccgcggaggccgggggtgtgctgcacatcgacggcggtgcg
gcccaggccatggagcaccacaactcgctgctgccggtgggcatcaccaagatcacgggc
gacttcacctcccgtgaggtggtggacatcgtcggtcccggtggccacctcatcggtcgt
ggcgaggtgaactacgacgccgccaccctggccggcctcatgggcaagtccagtgacgaa
ctgccggacttcgcgcagcgcccggcggtgcatgtcgacaacctgtcgacctacgccaac
cgcctgtcccgggactacggcgccacccgctag

DBGET integrated database retrieval system