KEGG   Corynebacterium variabile: CVAR_0931Help
Entry
CVAR_0931         CDS       T01594                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_0931 (gpmB)
   01230 Biosynthesis of amino acids
    CVAR_0931 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_0931 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    CVAR_0931 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_0931 (gpmB)
Enzymes [BR:cva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     CVAR_0931 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055661..1056443
Genome map
AA seq 260 aa AA seqDB search
MSGTAGSPARPERRLLLIRHGQTEFNKAGRMQGQLDTPLSDAGRDEAIRVAEGLADWPIG
TVVSSDLERAVDTAAALAGALFAEARQFTTDPRLRETDLGEWSGRAHEDVDASFPGARSH
WRLNPRWAPPGGETRLEVSARAAEVVTELMASDAWDRGAVALVAHGGTISALTCRLLGIP
VDHYAMLGGLGNTRWSQVVARPSDAWAPGSGRPWWESPRWFLEGWNVGVSMPSPVAVVNA
DEGTDTDGEPGTPESSGGAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaacagcgggatcaccagcgcgtccggagcgtcgtctcctgctgatccgtcat
ggccagaccgagttcaacaaggccggtcggatgcaggggcagctcgacacgccgctgagt
gacgccggtcgggacgaggccatccgggtcgccgagggcctcgcggactggccgatcggc
accgtcgtctcctccgacctggaacgcgcggtggataccgccgccgcgctcgccggggca
ctgttcgcggaggcccggcagttcacgacggacccccgactgcgggagaccgacctcggg
gagtggtcggggcgcgcccacgaggacgtggacgcgagcttccccggcgcccggtcccac
tggcggctcaacccgcggtgggcaccgccgggcggggagacccgcctggaggtctcggca
cgggcggcggaggtcgtcaccgagctgatggcctcggacgcctgggaccgtggtgcggtc
gcactcgtcgcccacggcgggacgatctccgccctgacctgccgtctgctggggatcccg
gtggatcactacgcgatgctcggcggcctggggaacacccgctggtcgcaggtcgtcgcc
cgcccctcggacgcctgggcacccgggtcagggaggccctggtgggagagcccacgctgg
ttcctcgagggctggaacgtcggtgtgtcgatgccgtcgccggtggccgtcgtcaacgcc
gacgaggggacggacaccgacggtgagccgggcacccctgaatcctcaggtggtgcggca
tga

DBGET integrated database retrieval system