KEGG   Corynebacterium variabile: CVAR_0931Help
Entry
CVAR_0931         CDS       T01594                                 

Gene name
gpmB
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_0931 (gpmB)
   01230 Biosynthesis of amino acids
    CVAR_0931 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_0931 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    CVAR_0931 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_0931 (gpmB)
Enzymes [BR:cva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     CVAR_0931 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055661..1056443
Genome map
AA seq 260 aa AA seqDB search
MSGTAGSPARPERRLLLIRHGQTEFNKAGRMQGQLDTPLSDAGRDEAIRVAEGLADWPIG
TVVSSDLERAVDTAAALAGALFAEARQFTTDPRLRETDLGEWSGRAHEDVDASFPGARSH
WRLNPRWAPPGGETRLEVSARAAEVVTELMASDAWDRGAVALVAHGGTISALTCRLLGIP
VDHYAMLGGLGNTRWSQVVARPSDAWAPGSGRPWWESPRWFLEGWNVGVSMPSPVAVVNA
DEGTDTDGEPGTPESSGGAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaacagcgggatcaccagcgcgtccggagcgtcgtctcctgctgatccgtcat
ggccagaccgagttcaacaaggccggtcggatgcaggggcagctcgacacgccgctgagt
gacgccggtcgggacgaggccatccgggtcgccgagggcctcgcggactggccgatcggc
accgtcgtctcctccgacctggaacgcgcggtggataccgccgccgcgctcgccggggca
ctgttcgcggaggcccggcagttcacgacggacccccgactgcgggagaccgacctcggg
gagtggtcggggcgcgcccacgaggacgtggacgcgagcttccccggcgcccggtcccac
tggcggctcaacccgcggtgggcaccgccgggcggggagacccgcctggaggtctcggca
cgggcggcggaggtcgtcaccgagctgatggcctcggacgcctgggaccgtggtgcggtc
gcactcgtcgcccacggcgggacgatctccgccctgacctgccgtctgctggggatcccg
gtggatcactacgcgatgctcggcggcctggggaacacccgctggtcgcaggtcgtcgcc
cgcccctcggacgcctgggcacccgggtcagggaggccctggtgggagagcccacgctgg
ttcctcgagggctggaacgtcggtgtgtcgatgccgtcgccggtggccgtcgtcaacgcc
gacgaggggacggacaccgacggtgagccgggcacccctgaatcctcaggtggtgcggca
tga

DBGET integrated database retrieval system