KEGG   Corynebacterium variabile: CVAR_0931Help
Entry
CVAR_0931         CDS       T01594                                 

Gene name
gpmB
Definition
(GenBank) phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
cva  Corynebacterium variabile
Brite
Enzymes [BR:cva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     CVAR_0931 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1055661..1056443
Genome map
AA seq 260 aa AA seqDB search
MSGTAGSPARPERRLLLIRHGQTEFNKAGRMQGQLDTPLSDAGRDEAIRVAEGLADWPIG
TVVSSDLERAVDTAAALAGALFAEARQFTTDPRLRETDLGEWSGRAHEDVDASFPGARSH
WRLNPRWAPPGGETRLEVSARAAEVVTELMASDAWDRGAVALVAHGGTISALTCRLLGIP
VDHYAMLGGLGNTRWSQVVARPSDAWAPGSGRPWWESPRWFLEGWNVGVSMPSPVAVVNA
DEGTDTDGEPGTPESSGGAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaacagcgggatcaccagcgcgtccggagcgtcgtctcctgctgatccgtcat
ggccagaccgagttcaacaaggccggtcggatgcaggggcagctcgacacgccgctgagt
gacgccggtcgggacgaggccatccgggtcgccgagggcctcgcggactggccgatcggc
accgtcgtctcctccgacctggaacgcgcggtggataccgccgccgcgctcgccggggca
ctgttcgcggaggcccggcagttcacgacggacccccgactgcgggagaccgacctcggg
gagtggtcggggcgcgcccacgaggacgtggacgcgagcttccccggcgcccggtcccac
tggcggctcaacccgcggtgggcaccgccgggcggggagacccgcctggaggtctcggca
cgggcggcggaggtcgtcaccgagctgatggcctcggacgcctgggaccgtggtgcggtc
gcactcgtcgcccacggcgggacgatctccgccctgacctgccgtctgctggggatcccg
gtggatcactacgcgatgctcggcggcctggggaacacccgctggtcgcaggtcgtcgcc
cgcccctcggacgcctgggcacccgggtcagggaggccctggtgggagagcccacgctgg
ttcctcgagggctggaacgtcggtgtgtcgatgccgtcgccggtggccgtcgtcaacgcc
gacgaggggacggacaccgacggtgagccgggcacccctgaatcctcaggtggtgcggca
tga

DBGET integrated database retrieval system