KEGG   Corynebacterium variabile: CVAR_1073Help
Entry
CVAR_1073         CDS       T01594                                 

Definition
putative oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cva  Corynebacterium variabile
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CVAR_1073
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     CVAR_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1234417..1236174)
Genome map
AA seq 585 aa AA seqDB search
MASSATHYDVLIVGSGFGGSVSALRLTEKGYSVGVIEAGRRFEDKDFAKTSWHLKDFLWA
PKLGFYGIQRVHLLKDAMILAGAGVGGGSLNYANTLYKPGDNYFHSPAWDHITDWEDELT
PYYEQARRMLGVVTNPTVTPADKLSKQVAEEMGVGDTFRMTPVGVFFGKKVGLEGEEGET
VADPYFGGVGPDRTACTECGECMTGCRHGAKNTLLKNYLYLAEKAGTEVHDRSTVTSVRK
LGADDEPGWEITVERTGPVFGKKKTTTFTSDYIIMAAGTWGTQNLLHRQKEDGNLPKLSD
HLGQLTRTNSEALLGVGLWKKEPEYDFHKGVAITSSYWPAPDTHIEPVRYGIGSNAMGML
QTMNTDGDTKWPRWVEFLRQLAKNPKAVKLVLDLRGWSERTMINLVMQARDNSLTTSLKK
LGPLRLLTSRQGEGEPNPSWIPEGNEATRRGAAHFDKAVAGGVWPEVFNIPLTAHFLGGC
TISDTPETGVVDPYHRVWNYPSMFITDGSSITANPGVNPSLSISANAERAAALWPNKGEA
DPRPAQSGIIGNYRRVDAVQPHGPVVPASAPGALRLPLTVVKSAV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcggccacgcactatgacgttctcatcgtcggctccggattcggcggatcc
gtctccgccctgcgcctgactgagaagggctactccgtcggtgtcatcgaggcaggacgc
cgtttcgaggacaaggacttcgcgaagacctcctggcacctcaaggatttcctctgggcc
ccgaaactcggcttctacggcatccagcgcgtccacctgctcaaggacgccatgatcctc
gccggtgccggtgtcggcggcggctccctgaactacgccaacaccctctacaagcccggc
gacaactacttccactcccccgcctgggaccacatcaccgactgggaggacgagctcacc
ccctactacgagcaggcacgcaggatgcttggcgtggtcaccaaccccaccgtcaccccg
gcggacaaactgtcgaagcaggtcgccgaggagatgggtgtcggcgacaccttccggatg
accccggtcggcgtcttcttcggcaagaaggtcggtctggagggtgaggagggcgagacc
gtcgccgacccctacttcggtggtgtcggccccgaccgcaccgcctgcaccgagtgcggc
gagtgcatgaccggttgccgccacggcgcgaagaacaccctgctgaagaactacctctac
ctcgcagagaaggccggcaccgaggtccacgaccgatccacggtgacctccgtacgcaag
ctcggtgccgacgacgaacccggctgggagatcaccgtcgagcgcaccggaccggtgttc
gggaagaagaagaccacgacgttcacgagcgactacatcatcatggccgccggaacgtgg
ggcacccagaacctgctgcaccgccagaaggaggacggcaacctgccgaagctctccgac
cacctcggccagctcacccgcaccaactccgaggccctgctgggtgtgggtctgtggaag
aaggagccggagtacgacttccacaagggcgtcgccatcacgtcgagctactggcccgca
ccggacacccacatcgagccggtccgctacggtatcggttccaatgccatgggcatgctg
cagaccatgaacaccgacggcgacacgaagtggccccgctgggtcgagttcctccgccag
ctcgcgaagaacccgaaggccgtcaagctggtcctcgacctgcgaggctggtcggagcgc
accatgatcaacctggtcatgcaggcccgcgacaactccctgaccaccagcctgaagaag
ctcggaccactgcgcctgctcaccagtcggcagggcgagggcgagccgaacccgtcctgg
atccccgagggcaacgaggcgacccgtcgcggtgccgcgcacttcgacaaggccgtcgcc
ggtggcgtctggccggaggtcttcaatatcccgctcaccgcccacttcctcggtggctgc
accatctccgacaccccggagaccggcgtggtcgacccctaccaccgggtgtggaactac
ccgtcgatgttcatcaccgacgggtcctcgatcaccgcgaatccgggcgtgaacccgtca
ctgtcgatctcggcgaacgcggagcgcgccgcagccctgtggcccaacaagggcgaagcg
gatccacgtccggcccagagcgggatcatcggaaactaccgtcgcgtggatgcggtccag
ccgcacggtccggtcgtcccggcgtccgccccgggggctctgcgcctgccgctgacagtg
gtgaagtccgccgtgtga

DBGET integrated database retrieval system