KEGG   Corynebacterium variabile: CVAR_1123Help
Entry
CVAR_1123         CDS       T01594                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cva  Corynebacterium variabile
Pathway
cva00020  Citrate cycle (TCA cycle)
cva00310  Lysine degradation
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CVAR_1123 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CVAR_1123 (sucB)
Enzymes [BR:cva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CVAR_1123 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2254 GCV_H Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: AEK36479
UniProt: G0HE87
Position
complement(1291576..1293267)
Genome map
AA seq 563 aa AA seqDB search
MAYSVEMPELGESVTEGTVTQWLKKVGDTVAADEPLLEVSTDKVDTEIPSPAAGVLLEIK
AEEDDTVDVGAVIAVIGEEGESAGDTGSSAPEAPAEKAEEPADEAPAEEKTGSAAPAASG
DATDVKMPELGESVTEGTVTNWLKKVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTLVEIL
ADEDDTVDVGAVIARIGDGSAAAAPAEKKADPKPEPEEETKQEPKAEEKPAPKAEPEPKK
EAPKAEAKAEPKSEPAAGNLPYVTPLVRKLAEKHGVDLSTVTGSGVGGRIRKQDVLAAAE
AGSTGTEAAPAAVVLKGSDPAKASLRGTTAKVNRIRAITAKTTLESLHGAAQLTQVHEVD
MTRVAELRKSSKAVFQDKYGVNLTYLPFFAKAVVEALLAHPNVNASYNAETQEMTYHDSV
NLSFAVDTPEGLISPVVHNAQDLSLPELAQAIVDIADRARNKKLKPNDIMGGTFTITNIG
SEGALTDTPILVPPQAAMLGTGAIVKRPVVISEDGQDAISIRQMVFLPMTYDHQVIDGAD
AGRFLTSIKDRLENYDFTGDLAL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactccgtcgaaatgcccgaactgggcgagtccgtgaccgaaggcactgtgacc
cagtggctgaagaaggtcggtgacactgtcgccgcggacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgagatcccctccccggccgctggcgtgctgctggagatcaag
gcggaggaggacgacaccgtcgacgtgggtgccgtcatcgccgtcatcggcgaagagggg
gagagtgccggggacaccggctcttccgctcctgaggctccggccgagaaggccgaggag
cccgcggatgaggcacccgccgaggagaagaccgggtccgctgcaccggccgcctccggc
gacgccaccgacgtgaagatgccggaactcggtgagtccgtcaccgagggcaccgtcacc
aactggctcaagaaggtcggcgacaccgtcgacgtcgacgagcccctcctcgaggtctcc
accgacaaggtcgacaccgaggtcccctcccccgtcgccggcaccctcgtcgagatcctc
gctgacgaagacgacaccgtcgacgtcggcgccgtcatcgcccgcatcggcgacggctcc
gccgccgctgccccggccgagaagaaggccgacccgaagccggagcccgaggaagagacc
aagcaagagcccaaggcagaggagaagcccgcccccaaggcggagccggagccgaagaag
gaggccccgaaggccgaggccaaggctgagccgaagtccgagcccgccgccggcaacctc
ccctacgtcaccccgctggtgcgcaagctcgccgagaagcacggcgtggacctgtccacc
gtcaccggttccggtgtcggcggccgtatccgcaagcaggatgtcctcgccgccgccgag
gctggctccacggggaccgaggctgctccggccgccgtcgtgctcaagggttccgatccg
gccaaggcgtccctgcgaggcaccaccgctaaggtcaaccggatccgtgcgatcaccgcg
aagaccaccctggagtccctccacggtgccgcgcagctcacccaggtccacgaggtcgac
atgacccgcgtcgccgaactgcgcaagtcctccaaggccgtcttccaggacaagtacggt
gtcaacctcacctacctgcccttcttcgccaaggccgtcgtcgaggccctcctggcccac
ccgaacgtcaacgcgtcctacaacgccgagacccaggagatgacctaccacgactcggtc
aacctgagcttcgccgtggacaccccggagggcctcatctccccggtcgtccacaacgcc
caggacctgtccctgccggagctggcccaggccatcgtcgacatcgccgaccgcgcccgg
aacaagaagctcaagccgaacgacatcatgggcggcaccttcaccatcaccaacatcggt
tccgaaggcgccctgaccgacaccccgatcctcgtgccgccgcaggccgcgatgctcggc
accggcgccatcgtcaagcgcccggtggtcatctccgaggacggccaggacgccatcagc
atccgccagatggtcttcctcccgatgacctacgaccaccaggtcatcgacggtgccgat
gccggtcgcttcctgaccagcatcaaggaccgtctggagaactacgacttcaccggtgac
ctcgccctctag

DBGET integrated database retrieval system