KEGG   Corynebacterium variabile: CVAR_1140Help
Entry
CVAR_1140         CDS       T01594                                 

Gene name
glk
Definition
glucose kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_1140 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_1140 (glk)
   00052 Galactose metabolism
    CVAR_1140 (glk)
   00500 Starch and sucrose metabolism
    CVAR_1140 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CVAR_1140 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CVAR_1140 (glk)
   00524 Butirosin and neomycin biosynthesis
    CVAR_1140 (glk)
Enzymes [BR:cva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CVAR_1140 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1312717..1313688
Genome map
AA seq 323 aa AA seqDB search
MDADVSTSEQLTIGIDIGGTNLRAAVVDGTGSIIDIEQLPTPSSVNALETAISHVVGILR
GRHEVAAVGLAVAGFITADQTSVRFAPHLPWRDMEIRDRLTRVLGLPVVLEHDANAAAWG
EQILGPGRDAGTWAFFAVGTGIGGALVTDGRIYRGAFGTAPEFGHLTVVQGGRSCPCGKR
GCLERYCSGSALELTAREFIATGRHPRSALAEHYHSAPEGITGRAVVNLAREGDVLAREV
IADFARWLGRGLAVVQEILDPELIVLGGGVSRDSDLYLTEAVAEMSQNVVGAGHRPLARV
ETGVLGADAGMIGVALLAGAVNP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcggacgtgtcaacgagtgaacagctgaccatcggtatcgacatcggcggaacg
aaccttcgcgccgcggtcgtggacgggaccggctcgatcatcgacatcgagcagcttccc
accccgagctcggtcaacgcgctcgagaccgccatcagccacgtcgtcggcatcctccgg
ggacgccacgaggtcgctgctgtgggactggccgtcgccgggttcatcaccgccgaccag
acctccgtccgtttcgccccgcatctgccgtggcgtgacatggagatccgcgaccggctg
acccgcgtcctcggtcttcctgtggtcctggagcacgacgccaacgccgcagcctggggt
gagcagatcctcggccccggccgcgacgccggtacctgggccttcttcgccgtcggtacc
ggcatcggcggtgcgctggtcaccgacggccgcatctaccgtggtgccttcggtaccgcg
ccggagttcggtcacctcaccgtggtccagggtggacgctcctgcccctgcggcaagcgc
ggctgcctggagcgctactgctccggcagtgcgctggagctcaccgcccgcgagttcatc
gccaccggtcggcacccccgcagtgccctcgccgagcactaccactccgccccggagggc
atcaccggccgcgccgtggtgaatctcgcccgtgaaggcgatgtgctggcccgcgaggtc
atcgccgacttcgcccgctggctcggccgcggtctggccgtggtgcaggagatcctcgac
cccgaactcatcgtcctgggcggcggcgtgagccgtgattccgacctctacctgaccgag
gccgtcgccgagatgtcccagaatgtcgtcggtgccggccaccgtccgctcgcgagggtg
gagacgggagtcctcggagcggacgcaggtatgatcggcgtggcgcttctcgccggagca
gtgaacccctga

DBGET integrated database retrieval system