KEGG   Corynebacterium variabile: CVAR_1157Help
Entry
CVAR_1157         CDS       T01594                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cva  Corynebacterium variabile
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CVAR_1157
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CVAR_1157
Enzymes [BR:cva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CVAR_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332371..1334014
Genome map
AA seq 547 aa AA seqDB search
MTSQTSPSRPTRPTLAQLAELTGGRLVDVAGTAAGVASAEQGQQTVATAAIDARDVPADG
LFMAVPGTRAHGARFAGQSAGHSVLTDEEGLGVLVDGSWQGTALVVDDCRQWLGPVAAEI
HGHPSRDMTVIGVTGTSGKTTTTYMMERALLGHRHVGLIGTTGTRIDGRKIPTSLTTPEA
PTLQALFARMRDEGVTHVVMEVSSHALVLGRVRGVDFDVAGFTNLSQDHLDFHPTMEDYF
DAKSMLFTEPQDPAGELPVPVVCVDDEWGRRLAGRTGDATVTVSTDGEAATWQVSDVAVH
PDGTQHVTVDRADGQVEYDLSIPGAFNVANATLALATLVAAGEDASIADELAEVSVPGRM
EKISGSSPQTAVDFLALVDYAHKPGAVTAVLDTLNGQLDRAAAGGNGATRGRLGVVLGAG
GNRDHEKRPKMGAAAAAVADLVIVTDDNPRDEDPATIRAAVLAGAGDAAAQRTDGVSPEI
REIGDRAEAIRDAVGWARSGDVVVVAGKGHESGQIIGDTVVDFDDRVELADALAALDLHS
DTKDSEA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcagacaagcccgtcacgtccgacccgtcccacgctcgcccagctcgcggag
ctgacgggcgggcgcctcgtcgacgtggccggcactgcagcgggcgtggcgagcgccgag
caggggcagcagaccgtcgcgaccgccgccatcgacgcccgcgacgtccctgccgacggc
ctgttcatggcggtgccgggcacccgtgcccacggagcccggttcgccggtcagtccgcc
ggacacagtgtgctcaccgacgaggaggggctcggcgtcctcgtggacgggtcctggcag
ggcactgccctcgtggtcgacgactgccggcagtggctcggtcccgtcgccgcggagatc
cacggtcatccctcgcgggacatgaccgtcatcggcgtcaccggtaccagcggcaagacg
accacgacctacatgatggagcgtgccctgctggggcaccgccacgtcggactcatcggc
accaccgggaccaggatcgacggccggaagatcccgacctcactgaccacccccgaggcg
ccgacgctccaggcgctcttcgcccggatgagggacgagggcgtgacccacgtggtcatg
gaggtctcctcccacgccctggtcctcggccgggtccgcggcgtcgacttcgacgtcgcc
gggttcaccaacctctcccaggaccacctcgacttccatccgacgatggaggactacttc
gacgcgaagtccatgctgttcaccgagccgcaggaccccgccggtgaactaccggtcccc
gtcgtctgcgtcgacgacgagtggggccggcgcctcgcggggcgtaccggggacgccacc
gtcaccgtctccaccgatggggaggccgcgacctggcaggtcagcgacgtcgccgtccac
cccgacggcacccagcacgtcaccgtggaccgtgcggacgggcaggtggagtacgacctg
tcgatcccgggcgccttcaacgtcgccaacgccactctcgccctggccaccctcgtggcc
gccggggaggacgcctccatcgccgacgagctggccgaggtcagcgtcccgggccgcatg
gagaagatctccggctcctccccacagaccgcggtcgatttcctcgccctggtggactac
gcccacaagcccggtgccgtcaccgcagtgctggacaccctcaacggccagctcgaccgc
gccgccgccggcgggaacggcgccacacgcggccgactcggcgtcgtgctgggtgccggt
ggcaaccgtgaccatgagaagcgtccgaagatgggtgccgcggcggccgccgtcgccgac
ctcgtcatcgtcaccgacgacaatccgcgtgacgaggaccccgcgaccatccgcgccgcc
gtcctggccggtgccggggatgctgcggcacagcgcaccgacggtgtgtcgcccgagatc
cgggagatcggcgaccgcgccgaggctatccgggacgcggtcggctgggcccgctccggt
gatgtcgtcgtcgtggcaggcaagggccacgaatccggacagatcatcggggacaccgtc
gtcgacttcgacgacagggtggaactcgcggacgcactcgccgcactcgacctacattcc
gacaccaaggactctgaagcatga

DBGET integrated database retrieval system