KEGG   Corynebacterium variabile: CVAR_1211Help
Entry
CVAR_1211         CDS       T01594                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cva  Corynebacterium variabile
Pathway
cva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01130  Biosynthesis of antibiotics
cva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVAR_1211 (trpC)
Enzymes [BR:cva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CVAR_1211 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEK36567
UniProt: G0HAG0
Position
1389682..1390518
Genome map
AA seq 278 aa AA seqDB search
MAGVTGGYDNAMTVLDEIIAGVLEDTARREAEVPLSEIKARALDAPAPLDALAALSAPSV
SVIAEVKRASPSKGHLAEIPEPEVLAKAYEANGAAVISCLTEQRRFHGSLADFDKVRANV
NIPLLRKDFTTTPYQIHEARAHGADVILLIVAALEQDQLAALLDRTESLGMTALVEVHTV
EEAERAVAVGAKVIGVNARNLKTLEVDTGVFSRIAPVIPEGIVKVAESGVKSKTDLQTYA
AGGADAILVGEGLVTSPNPGQACRSLVAAGQHPAFPRA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgtcacgggcggttacgataacgccatgactgtgctcgacgagatcattgcc
ggtgtcctggaggacaccgcccgccgcgaggccgaggtccccctctccgagatcaaggcc
cgtgccctggacgccccggctcccctggacgccctcgccgccctctccgccccctccgtc
agtgtcatcgccgaggtcaagcgcgcgagcccttcgaaggggcatctggcggagatcccg
gagccggaggtgctggccaaggcctacgaggccaacggtgccgcggtgatcagctgcctc
accgagcagcgacggttccacgggtccctggcggacttcgacaaggtccgcgccaatgtg
aacatccccctgctgcgcaaggacttcaccaccaccccgtaccagatccatgaggccagg
gcgcacggtgcggacgtcatcctgctcatcgtcgccgccctggaacaggaccagctcgcc
gctctgctggaccgcaccgaatccctgggcatgaccgccctggtcgaggtccacaccgtc
gaggaggcggagcgggccgtcgccgtgggcgcgaaggtcatcggcgtcaacgcccgcaac
ctcaagaccctcgaggtcgacacgggcgtgttcagcaggatcgccccggtcatccccgaa
gggatcgtgaaggtcgccgagtccggtgtgaagtccaagaccgatctgcagacctatgcc
gcgggcggggcggacgccatcctcgtcggcgaaggtctggtcacctctccgaacccgggc
caggcctgccggtcgctggtggccgccggccagcaccctgcgttcccgcgcgcctga

DBGET integrated database retrieval system