KEGG   Corynebacterium variabile: CVAR_1211Help
Entry
CVAR_1211         CDS       T01594                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cva  Corynebacterium variabile
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cva01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cva00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389682..1390518
Genome map
AA seq 278 aa AA seqDB search
MAGVTGGYDNAMTVLDEIIAGVLEDTARREAEVPLSEIKARALDAPAPLDALAALSAPSV
SVIAEVKRASPSKGHLAEIPEPEVLAKAYEANGAAVISCLTEQRRFHGSLADFDKVRANV
NIPLLRKDFTTTPYQIHEARAHGADVILLIVAALEQDQLAALLDRTESLGMTALVEVHTV
EEAERAVAVGAKVIGVNARNLKTLEVDTGVFSRIAPVIPEGIVKVAESGVKSKTDLQTYA
AGGADAILVGEGLVTSPNPGQACRSLVAAGQHPAFPRA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgtcacgggcggttacgataacgccatgactgtgctcgacgagatcattgcc
ggtgtcctggaggacaccgcccgccgcgaggccgaggtccccctctccgagatcaaggcc
cgtgccctggacgccccggctcccctggacgccctcgccgccctctccgccccctccgtc
agtgtcatcgccgaggtcaagcgcgcgagcccttcgaaggggcatctggcggagatcccg
gagccggaggtgctggccaaggcctacgaggccaacggtgccgcggtgatcagctgcctc
accgagcagcgacggttccacgggtccctggcggacttcgacaaggtccgcgccaatgtg
aacatccccctgctgcgcaaggacttcaccaccaccccgtaccagatccatgaggccagg
gcgcacggtgcggacgtcatcctgctcatcgtcgccgccctggaacaggaccagctcgcc
gctctgctggaccgcaccgaatccctgggcatgaccgccctggtcgaggtccacaccgtc
gaggaggcggagcgggccgtcgccgtgggcgcgaaggtcatcggcgtcaacgcccgcaac
ctcaagaccctcgaggtcgacacgggcgtgttcagcaggatcgccccggtcatccccgaa
gggatcgtgaaggtcgccgagtccggtgtgaagtccaagaccgatctgcagacctatgcc
gcgggcggggcggacgccatcctcgtcggcgaaggtctggtcacctctccgaacccgggc
caggcctgccggtcgctggtggccgccggccagcaccctgcgttcccgcgcgcctga

DBGET integrated database retrieval system