KEGG   Corynebacterium variabile: CVAR_1212Help
Entry
CVAR_1212         CDS       T01594                                 

Gene name
trpB
Definition
Tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cva  Corynebacterium variabile
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CVAR_1212 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_1212 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVAR_1212 (trpB)
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CVAR_1212 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1390558..1391874
Genome map
AA seq 438 aa AA seqDB search
MSTPSTESAKNPLGLPTAGEVIATPTAHDADERGHWGDYGGRYIPEALMAVVTEIEDAWG
KARVDPNFLETLDDLHRNYTGRPSPLYYGPNFSKAVGAKVYFKREDLNHTGSHKINNVLG
QVLLAKRMGKDNVIAETGAGQHGVATATACALLGLNCRIYMGEVDAKRQALNIARMRLLG
AEVVEVTAGSATLKDAINEAMRFWVSHAEDTYYAFGTAAGPHPFPEMVRDLQRVIGVEAR
EQILAAEGRLPDAVLACVGGGSNAIGLFHRFIDDESVALLGAEAGGDGVETGRHAAPITV
GSEGVFQGSFAALMQNEDGQIIESHSISAGLDYPGVGPEHSFLANIGRAEYLPVTDTEAM
DAFRLLTRTEGIIPAIESAHAVALAVKIAAEYTDGTRTTADGREPVFIVNVSGRGDKDVD
TAATWFNMRPADSEENAR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactcccagtactgaatccgcgaagaaccccctgggtctccccactgccggtgag
gtcatcgcgacccccaccgcccatgacgccgacgagcgcggccactggggggactacggc
gggcgctacatccccgaggccctcatggccgtcgtcaccgagatcgaggacgcctggggt
aaggcccgggtcgacccgaacttcctggagaccctcgacgacctgcaccggaactacacc
ggtcggccgtccccgctgtactacggcccgaacttctcgaaagccgtaggggcgaaggtc
tacttcaagcgcgaggacctgaaccacacgggctcgcacaagatcaacaacgtcctgggc
caggtcctgctcgccaagcggatgggcaaggacaacgtcatcgccgagaccggtgccggc
cagcacggtgtcgccacggccaccgcgtgtgccctgttggggctgaactgccggatctac
atgggcgaggtcgacgcgaagcgccaggccctcaacatcgcccggatgcgactgctcggc
gcggaggtcgtagaggtcaccgcggggtccgcgacgctgaaggacgccatcaacgaggcc
atgcgtttctgggtctcccacgccgaggacacctactacgccttcggtaccgccgccggc
ccgcaccccttcccggagatggtccgtgacctgcagcgcgtcatcggtgtcgaggcccgt
gagcagatcctcgccgccgagggacgcctgccggacgccgtgctggcctgcgtcggtggc
ggctcgaacgccatcggtctcttccaccgcttcatcgacgacgaatccgtcgccctgctc
ggcgccgaggccggcggtgacggtgtggagaccggtcgtcacgccgccccgatcaccgtc
gggtccgagggtgtcttccagggctccttcgccgccctgatgcagaacgaggacggccag
atcatcgagtcccactcgatctccgccggtctggactacccgggcgtcggtccggagcac
tccttcctcgcgaacatcggccgggcggagtacctgccggtcaccgacaccgaggcgatg
gacgcgttccggctgctgacccgtaccgagggcatcatcccggcgatcgagtccgcgcat
gccgtcgctctggcggtgaagatcgccgccgagtacaccgacggcacccgtaccaccgcc
gacggcagggagccggtgttcatcgtcaacgtctccggccgtggtgacaaggacgtcgac
accgccgcgacgtggttcaacatgcgccctgccgattctgaggagaacgcccgatga

DBGET integrated database retrieval system