KEGG   Corynebacterium variabile: CVAR_1212Help
Entry
CVAR_1212         CDS       T01594                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cva  Corynebacterium variabile
Pathway
cva00260  Glycine, serine and threonine metabolism
cva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01130  Biosynthesis of antibiotics
cva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_1212 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVAR_1212 (trpB)
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CVAR_1212 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEK36568
UniProt: G0HAG1
Position
1390558..1391874
Genome map
AA seq 438 aa AA seqDB search
MSTPSTESAKNPLGLPTAGEVIATPTAHDADERGHWGDYGGRYIPEALMAVVTEIEDAWG
KARVDPNFLETLDDLHRNYTGRPSPLYYGPNFSKAVGAKVYFKREDLNHTGSHKINNVLG
QVLLAKRMGKDNVIAETGAGQHGVATATACALLGLNCRIYMGEVDAKRQALNIARMRLLG
AEVVEVTAGSATLKDAINEAMRFWVSHAEDTYYAFGTAAGPHPFPEMVRDLQRVIGVEAR
EQILAAEGRLPDAVLACVGGGSNAIGLFHRFIDDESVALLGAEAGGDGVETGRHAAPITV
GSEGVFQGSFAALMQNEDGQIIESHSISAGLDYPGVGPEHSFLANIGRAEYLPVTDTEAM
DAFRLLTRTEGIIPAIESAHAVALAVKIAAEYTDGTRTTADGREPVFIVNVSGRGDKDVD
TAATWFNMRPADSEENAR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactcccagtactgaatccgcgaagaaccccctgggtctccccactgccggtgag
gtcatcgcgacccccaccgcccatgacgccgacgagcgcggccactggggggactacggc
gggcgctacatccccgaggccctcatggccgtcgtcaccgagatcgaggacgcctggggt
aaggcccgggtcgacccgaacttcctggagaccctcgacgacctgcaccggaactacacc
ggtcggccgtccccgctgtactacggcccgaacttctcgaaagccgtaggggcgaaggtc
tacttcaagcgcgaggacctgaaccacacgggctcgcacaagatcaacaacgtcctgggc
caggtcctgctcgccaagcggatgggcaaggacaacgtcatcgccgagaccggtgccggc
cagcacggtgtcgccacggccaccgcgtgtgccctgttggggctgaactgccggatctac
atgggcgaggtcgacgcgaagcgccaggccctcaacatcgcccggatgcgactgctcggc
gcggaggtcgtagaggtcaccgcggggtccgcgacgctgaaggacgccatcaacgaggcc
atgcgtttctgggtctcccacgccgaggacacctactacgccttcggtaccgccgccggc
ccgcaccccttcccggagatggtccgtgacctgcagcgcgtcatcggtgtcgaggcccgt
gagcagatcctcgccgccgagggacgcctgccggacgccgtgctggcctgcgtcggtggc
ggctcgaacgccatcggtctcttccaccgcttcatcgacgacgaatccgtcgccctgctc
ggcgccgaggccggcggtgacggtgtggagaccggtcgtcacgccgccccgatcaccgtc
gggtccgagggtgtcttccagggctccttcgccgccctgatgcagaacgaggacggccag
atcatcgagtcccactcgatctccgccggtctggactacccgggcgtcggtccggagcac
tccttcctcgcgaacatcggccgggcggagtacctgccggtcaccgacaccgaggcgatg
gacgcgttccggctgctgacccgtaccgagggcatcatcccggcgatcgagtccgcgcat
gccgtcgctctggcggtgaagatcgccgccgagtacaccgacggcacccgtaccaccgcc
gacggcagggagccggtgttcatcgtcaacgtctccggccgtggtgacaaggacgtcgac
accgccgcgacgtggttcaacatgcgccctgccgattctgaggagaacgcccgatga

DBGET integrated database retrieval system