KEGG   Corynebacterium variabile: CVAR_1213Help
Entry
CVAR_1213         CDS       T01594                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cva  Corynebacterium variabile
Pathway
cva00260  Glycine, serine and threonine metabolism
cva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01130  Biosynthesis of antibiotics
cva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_1213 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVAR_1213 (trpA)
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CVAR_1213 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: AEK36569
UniProt: G0HAG2
Position
1391871..1392644
Genome map
AA seq 257 aa AA seqDB search
MTALSDIFTSARAEGRAAFVGYLPAGYPTADGALENLSTLARHADLVEVGIPFSDPMMDG
PTIQAAGTEALSNGFRVHDTFAAVEAVVAAGSNAVIMSYWNPILQYGPETFAEELAAAGG
LGSIIPDLLPEESERWNAACAANGLDNVYLVAPSTTPERLDMTVRAGGGFIYAQSHMGVT
GAQEDVSTDARGVVDRVRSATDLPVAVGLGVKSGDQAAAIADYADGVIVGSALITAAGQG
VDALDALAADLHDGVRR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctgtccgacatcttcacctcggcgcgcgccgaaggtcgtgccgccttcgtc
ggctatctcccggccggctatcccacggcggacggtgccctggagaacctgtccaccctg
gcccgtcacgcggaccttgtcgaggtcggtatcccgttcagtgacccgatgatggacggc
ccgacgatccaggccgccggcaccgaggcactgtccaacggtttccgcgtccacgacacc
ttcgccgccgtcgaggcagtcgtcgccgccggcagcaacgccgtgatcatgagctactgg
aatccgatcctgcagtacggtccggagacgttcgccgaggagctcgccgccgccggtggc
ctcggctcgatcatcccggacctgctgccggaggagtcggagcgctggaacgccgcctgt
gcggccaacggcctggacaatgtctacctcgtggcaccctcgacgacccccgagcgtctc
gacatgaccgtgcgcgccggtggtggattcatctacgcccagtcgcacatgggcgtcacc
ggcgcccaggaggacgtctccaccgacgcccgtggtgtggtggaccgggtccgctcggcc
accgacctgcccgtcgccgtgggtctcggcgtgaagagcggcgaccaggctgccgccatc
gccgactacgccgacggcgtcatcgtcggttcggcactgatcaccgccgccggtcagggg
gtcgatgcccttgacgcgctggccgccgacctgcacgacggcgtccggcggtga

DBGET integrated database retrieval system