KEGG   Corynebacterium variabile: CVAR_1213Help
Entry
CVAR_1213         CDS       T01594                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cva  Corynebacterium variabile
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CVAR_1213 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_1213 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CVAR_1213 (trpA)
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CVAR_1213 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1391871..1392644
Genome map
AA seq 257 aa AA seqDB search
MTALSDIFTSARAEGRAAFVGYLPAGYPTADGALENLSTLARHADLVEVGIPFSDPMMDG
PTIQAAGTEALSNGFRVHDTFAAVEAVVAAGSNAVIMSYWNPILQYGPETFAEELAAAGG
LGSIIPDLLPEESERWNAACAANGLDNVYLVAPSTTPERLDMTVRAGGGFIYAQSHMGVT
GAQEDVSTDARGVVDRVRSATDLPVAVGLGVKSGDQAAAIADYADGVIVGSALITAAGQG
VDALDALAADLHDGVRR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctgtccgacatcttcacctcggcgcgcgccgaaggtcgtgccgccttcgtc
ggctatctcccggccggctatcccacggcggacggtgccctggagaacctgtccaccctg
gcccgtcacgcggaccttgtcgaggtcggtatcccgttcagtgacccgatgatggacggc
ccgacgatccaggccgccggcaccgaggcactgtccaacggtttccgcgtccacgacacc
ttcgccgccgtcgaggcagtcgtcgccgccggcagcaacgccgtgatcatgagctactgg
aatccgatcctgcagtacggtccggagacgttcgccgaggagctcgccgccgccggtggc
ctcggctcgatcatcccggacctgctgccggaggagtcggagcgctggaacgccgcctgt
gcggccaacggcctggacaatgtctacctcgtggcaccctcgacgacccccgagcgtctc
gacatgaccgtgcgcgccggtggtggattcatctacgcccagtcgcacatgggcgtcacc
ggcgcccaggaggacgtctccaccgacgcccgtggtgtggtggaccgggtccgctcggcc
accgacctgcccgtcgccgtgggtctcggcgtgaagagcggcgaccaggctgccgccatc
gccgactacgccgacggcgtcatcgtcggttcggcactgatcaccgccgccggtcagggg
gtcgatgcccttgacgcgctggccgccgacctgcacgacggcgtccggcggtga

DBGET integrated database retrieval system