KEGG   Corynebacterium variabile: CVAR_1481Help
Entry
CVAR_1481         CDS       T01594                                 

Gene name
tpi
Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_1481 (tpi)
   01230 Biosynthesis of amino acids
    CVAR_1481 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_1481 (tpi)
   00051 Fructose and mannose metabolism
    CVAR_1481 (tpi)
   00562 Inositol phosphate metabolism
    CVAR_1481 (tpi)
Enzymes [BR:cva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CVAR_1481 (tpi)
Exosome [BR:cva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CVAR_1481 (tpi)
  Exosomal proteins of bladder cancer cells
   CVAR_1481 (tpi)
  Exosomal proteins of melanoma cells
   CVAR_1481 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693175..1693966)
Genome map
AA seq 263 aa AA seqDB search
MADKVQKRTPLIAGNWKMNLNHLEAIQLVQKFDFALPRDYYDHVDVAVIPPFTDIRSVQT
IVDGDKLLATYGAQDVSVHESGAYTGEVSAGMLAKLGCSWVVVGHSERRQYHAEDDATVA
QKAVATLGAGMRPIVCVGESLDVREAGDHVSFVEEQTRASLAGIPAGKLSEVVVAYEPVW
AIGTGKVASAGDAQEVCQAVRGVLRELGGDDVADSARILYGGSVKTGTVAEIVGQPDVDG
ALVGGASLDGEDFARLCAAAAKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaggtacagaagcgcacgccgctcatcgccggcaactggaagatgaacctc
aaccatctggaggccatccagctggtgcagaagttcgacttcgccctgccgcgcgactac
tacgaccatgtcgatgtggcggtcatcccacccttcaccgacatccgcagcgtccagacc
atcgtcgacggtgacaagctcctcgccacctacggggcgcaggacgtctcggtccacgag
tcgggcgcctacaccggtgaggtctccgccggcatgctcgccaagctgggctgctcctgg
gtcgtcgtaggccactcggagcgtcgccagtaccacgccgaggacgacgccaccgtcgcg
cagaaggccgtggccaccctcggtgccggtatgcgaccgatcgtgtgcgtgggggagtcc
ctcgacgtccgcgaggccggcgaccacgtctccttcgtcgaggagcagacccgtgcgtcg
ctcgccggtatccccgccggaaagctctctgaggtcgtcgtcgcatatgagccggtgtgg
gccatcggtaccggcaaggtcgcctccgccggtgacgcccaggaggtctgccaggcggtc
cgtggcgtcctgcgtgagctcggcggcgatgacgtcgccgacagcgcccggatcctctac
ggcggttcagtgaagaccggtaccgtcgccgagatcgtcggtcagcctgatgtcgacggt
gcactcgtcggcggcgccagcctcgacggtgaggacttcgcccggctctgcgctgcggca
gccaaggcctga

DBGET integrated database retrieval system