KEGG   Corynebacterium variabile: CVAR_1529Help
Entry
CVAR_1529         CDS       T01594                                 

Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cva  Corynebacterium variabile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CVAR_1529
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_1529
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CVAR_1529
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CVAR_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752114..1753568
Genome map
AA seq 484 aa AA seqDB search
MKYISTRDAQATPVDFTDILLGGLAPDGGLYLPQGYPSVDAATLDRWRSVLDNEGYATLA
AEVVSLFIDDIPVEDLKGITARAYSTPKFASAQIVPVTDLEPGVKIAHLSEGPTAAFKDM
AMQLLGELFEYVLRQRGETINILGATSGDTGSSAEYAMRGRAGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDIVKGVSGDAAFKAEYHIGAVNSINWARLMAQVVYY
VSSWIRATDSVEQKVSFCVPTGNFGDVCAGHIARQMGVPIDRLIVATNENDVLDEFFRTG
DYRVRTSAETLATSSPSMDISKASNFERFIFDVLGRDAARTADLFGTQVKQGGFSLAADP
AFPEVDKVYGFASGSSTHTDRLDTIRYCWESAGVLVDPHTADGVKVARDYLTTHPDAAPV
ICLETALPVKFAGTIRESIGSEPEAMTPERFRDILSADRHVTDLPNDVDTVKDFIRTSIA
DVQV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctccacgcgcgatgcgcaggccacgcccgtcgatttcaccgatatcctg
ctcggcggactggcccccgacggcggtctgtatctgccgcaggggtacccgtcggtggac
gccgcgacgctggaccggtggcgttccgttctcgacaacgagggctacgccactctcgcc
gccgaggtcgtctcgctgttcatcgacgacatccccgtcgaggacctcaagggcatcacc
gcccgggcatactccacgccgaagttcgcgtccgcgcagatcgtcccggtcaccgacctg
gagccgggtgtgaagatcgcccacctgtccgaggggcccaccgcggccttcaaggacatg
gccatgcagctgctcggtgagctgttcgaatacgtgctgcgccagcgcggcgagaccatc
aacatcctcggcgcgaccagcggcgacaccgggtcttcggccgagtacgccatgcgcgga
cgcgccggcatccgggtgttcatgctcaccccggccggccggatgacgcctttccagcag
gcacagatgttcggcctggacgaccccaacatcttcaacatcgcccttgacggtgtcttc
gatgactgccaggacatcgtcaagggtgtctccggggatgccgcattcaaggccgagtac
cacatcggtgcggtcaactcgatcaactgggcacggctgatggcccaggtcgtctactac
gtctccagctggatccgtgccaccgactcggtggagcaaaaggtctcgttctgcgtgccg
accggcaatttcggtgatgtctgcgccggccacatcgcccggcagatgggtgtgccgatc
gaccggctcattgtcgcgaccaacgagaacgacgtcctcgacgagttcttccgtaccggc
gactaccgcgtccgtacctccgctgagacgttggcgacctccagcccgtcgatggacatc
tccaaggcctcgaacttcgagcggttcatcttcgatgtcctcggacgcgatgccgcccgc
accgccgacctcttcggcacccaggtgaagcagggcgggttctccctggccgcagaccct
gccttcccggaggtggacaaggtctacggcttcgcctcgggctcctccacacacaccgac
cgcctcgacaccatccggtactgctgggagtccgccggagtactcgtcgacccgcacacc
gctgacggtgtgaaggtcgcccgcgactacctcaccacccacccggacgctgccccggtc
atctgcctggagaccgcgctgccggtgaagttcgccggcaccatccgagagtccatcggt
tccgagccggaggcgatgaccccggagcggttccgcgacatcctttcggctgaccggcac
gtcaccgacctgcccaatgacgtcgacacggtgaaggacttcatccggacctccatcgcc
gacgtgcaggtctag

  All links  
No link information was found.   
DBGET integrated database retrieval system