KEGG   Corynebacterium variabile: CVAR_1529Help
Entry
CVAR_1529         CDS       T01594                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cva  Corynebacterium variabile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CVAR_1529
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_1529
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CVAR_1529
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CVAR_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752114..1753568
Genome map
AA seq 484 aa AA seqDB search
MKYISTRDAQATPVDFTDILLGGLAPDGGLYLPQGYPSVDAATLDRWRSVLDNEGYATLA
AEVVSLFIDDIPVEDLKGITARAYSTPKFASAQIVPVTDLEPGVKIAHLSEGPTAAFKDM
AMQLLGELFEYVLRQRGETINILGATSGDTGSSAEYAMRGRAGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDIVKGVSGDAAFKAEYHIGAVNSINWARLMAQVVYY
VSSWIRATDSVEQKVSFCVPTGNFGDVCAGHIARQMGVPIDRLIVATNENDVLDEFFRTG
DYRVRTSAETLATSSPSMDISKASNFERFIFDVLGRDAARTADLFGTQVKQGGFSLAADP
AFPEVDKVYGFASGSSTHTDRLDTIRYCWESAGVLVDPHTADGVKVARDYLTTHPDAAPV
ICLETALPVKFAGTIRESIGSEPEAMTPERFRDILSADRHVTDLPNDVDTVKDFIRTSIA
DVQV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctccacgcgcgatgcgcaggccacgcccgtcgatttcaccgatatcctg
ctcggcggactggcccccgacggcggtctgtatctgccgcaggggtacccgtcggtggac
gccgcgacgctggaccggtggcgttccgttctcgacaacgagggctacgccactctcgcc
gccgaggtcgtctcgctgttcatcgacgacatccccgtcgaggacctcaagggcatcacc
gcccgggcatactccacgccgaagttcgcgtccgcgcagatcgtcccggtcaccgacctg
gagccgggtgtgaagatcgcccacctgtccgaggggcccaccgcggccttcaaggacatg
gccatgcagctgctcggtgagctgttcgaatacgtgctgcgccagcgcggcgagaccatc
aacatcctcggcgcgaccagcggcgacaccgggtcttcggccgagtacgccatgcgcgga
cgcgccggcatccgggtgttcatgctcaccccggccggccggatgacgcctttccagcag
gcacagatgttcggcctggacgaccccaacatcttcaacatcgcccttgacggtgtcttc
gatgactgccaggacatcgtcaagggtgtctccggggatgccgcattcaaggccgagtac
cacatcggtgcggtcaactcgatcaactgggcacggctgatggcccaggtcgtctactac
gtctccagctggatccgtgccaccgactcggtggagcaaaaggtctcgttctgcgtgccg
accggcaatttcggtgatgtctgcgccggccacatcgcccggcagatgggtgtgccgatc
gaccggctcattgtcgcgaccaacgagaacgacgtcctcgacgagttcttccgtaccggc
gactaccgcgtccgtacctccgctgagacgttggcgacctccagcccgtcgatggacatc
tccaaggcctcgaacttcgagcggttcatcttcgatgtcctcggacgcgatgccgcccgc
accgccgacctcttcggcacccaggtgaagcagggcgggttctccctggccgcagaccct
gccttcccggaggtggacaaggtctacggcttcgcctcgggctcctccacacacaccgac
cgcctcgacaccatccggtactgctgggagtccgccggagtactcgtcgacccgcacacc
gctgacggtgtgaaggtcgcccgcgactacctcaccacccacccggacgctgccccggtc
atctgcctggagaccgcgctgccggtgaagttcgccggcaccatccgagagtccatcggt
tccgagccggaggcgatgaccccggagcggttccgcgacatcctttcggctgaccggcac
gtcaccgacctgcccaatgacgtcgacacggtgaaggacttcatccggacctccatcgcc
gacgtgcaggtctag

DBGET integrated database retrieval system