KEGG   Corynebacterium variabile: CVAR_1546Help
Entry
CVAR_1546         CDS       T01594                                 

Definition
Holliday junction resolvasome helicase subunit A (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cva  Corynebacterium variabile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CVAR_1546
Enzymes [BR:cva01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CVAR_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774159..1774776)
Genome map
AA seq 205 aa AA seqDB search
MDKGLDHVVIECAGVGYLCQATARTLADLPRGEEVFVLTTMVVREDSQTLYAFPDVASRE
LFALVQSVSGVGARMAMALLSVLTPAEIAAAVAEGDVKTLQRAPGVGKRLADRMSVDLKG
KLDAYAVAQPSGAPGDAVDLTSGDAAVDDAVTAQVVEALVGLGFPEASAADTVTSLVAET
GGGDGSSPDASVLLRSALSRLGGRR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaggggctcgaccatgtcgtcatcgagtgcgccggagtcggctacctctgccag
gccaccgcacggacccttgccgacctgccccgcggtgaggaagtcttcgtcctcacgacc
atggtggtgcgtgaggactcgcagacgctctacgccttccccgacgtcgccagccgggaa
ctgttcgccctggtgcagagcgtctccggcgtcggtgcgcgcatggccatggccctgttg
tcggtactgaccccggccgagatcgccgccgccgtcgctgagggcgacgtgaagaccctc
cagcgcgccccgggcgtcggcaagcgcctggcagaccgcatgtccgtggacctcaagggc
aagctggacgcctacgcggtcgcacagccctccggtgccccgggtgacgccgtggacctg
acctccggtgacgcagcagtggatgacgccgtgaccgcacaggtcgtcgaggcactcgtc
ggcctcggcttcccggaggcttctgccgcggacacggtcacgtccctggtcgcggaaacc
ggtggaggcgacggctcgtccccggacgcctccgtactgctgcgcagtgccctttcccgc
ctcggcggacgacggtag

DBGET integrated database retrieval system