KEGG   Corynebacterium variabile: CVAR_1795Help
Entry
CVAR_1795         CDS       T01594                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_1795 (pfkA)
   01230 Biosynthesis of amino acids
    CVAR_1795 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_1795 (pfkA)
   00030 Pentose phosphate pathway
    CVAR_1795 (pfkA)
   00051 Fructose and mannose metabolism
    CVAR_1795 (pfkA)
   00052 Galactose metabolism
    CVAR_1795 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CVAR_1795 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CVAR_1795 (pfkA)
Enzymes [BR:cva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CVAR_1795 (pfkA)
Protein phosphatases and associated proteins [BR:cva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CVAR_1795 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2064529..2065557)
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGVVRTAAGHGATVIGYEDGWQGLVEDRRKQLYDDEDIDRI
LTRGGTILGTGRLPVDEFTGAIDRVKENLADAGIDALITIGGEGTLKGAQFLHEHGVPVV
GVPKTIDNDVNATDYTFGFDSAVAVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHDILIPEHPFDIEDVCTRMARRFQLGEKYGIIVVAEGAAPKEGTLEMAEREVDQ
FGHQKFGNVGALIAHEIQNRLDADVRSTVLGHIQRGGTPTAFDRVLATRYAVHATKAALR
GDFGLVVALRGEAIRLVSFDDAVGQLKCVPDHRWESALSLLG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcgaccctgaccagtggtggagactgtcccggactgaacgccgtcatccgg
ggggtggttcggacggcggcgggccacggtgccaccgtcatcggctacgaggacggctgg
cagggcctcgtcgaggaccgacgcaagcaactctacgacgacgaggacatcgaccgcatc
ctcacccgcggcggcaccatcctggggaccggacgcctgccggtcgacgagttcaccggg
gcgatcgaccgggtcaaggagaatctcgcggacgccgggatcgacgccctcatcaccatc
ggcggcgaggggacgctcaagggggcacagttcctccacgaacacggcgttccggtggtg
ggcgtgcccaagaccatcgacaacgacgtcaacgccaccgactacaccttcggtttcgac
tccgccgtggccgtggccaccgatgcgatcgaccggctccacaccaccgcggaatcccac
aaccgtgtgatgatcgtcgaggtcatgggacgccacgtcggctggatcgccctgcacgcc
ggcatggccggcggcgcccacgacatcctcatccccgagcaccccttcgacatcgaggac
gtctgtacccgcatggcccgtcgcttccagctgggggagaagtacgggatcatcgtcgtc
gccgagggcgcggcacccaaggaggggacgctggagatggcagagcgggaggttgaccag
ttcggccaccagaaattcggcaacgtcggcgcactgatcgcccacgagatccagaaccgg
ctggacgccgacgtgcgctccaccgtcctcggccacatccagcgcggtggcacaccgacc
gccttcgaccgggtgctggccacccgctacgccgtccacgccaccaaagccgcgctgcgc
ggggacttcggcctggttgtcgccctacgcggcgaagccatccggctggtcagtttcgac
gacgctgtgggtcagctcaagtgcgttccggaccaccggtgggagagcgccctgtcgctg
ctggggtga

DBGET integrated database retrieval system