KEGG   Corynebacterium variabile: CVAR_2068Help
Entry
CVAR_2068         CDS       T01594                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cva  Corynebacterium variabile
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CVAR_2068
   00052 Galactose metabolism
    CVAR_2068
   00500 Starch and sucrose metabolism
    CVAR_2068
   00520 Amino sugar and nucleotide sugar metabolism
    CVAR_2068
Enzymes [BR:cva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CVAR_2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2354434..2355378)
Genome map
AA seq 314 aa AA seqDB search
MTADNSLHNGGLRTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAREAAQAGASR
MAVVTAPRKQGIMAYFDRDELLESTLESRGKTAQLEKVQAVNTLVDAVAVNQDRPLGLGH
AVGCAESALDDDEDCFAVLLPDDLVLPFGVLNEMLEVRRRFGGTVLCGFEVPEDEVSNYG
VFDLEETDDSAGSQVRKVRGMVEKPDAEDAPSTVVAAGRYLLDRTIFDALRRIEPGKGGE
LQLTDAIELLIEEGHPVHVFIHQGGRHDLGNPGGYIRACVDFALNDDTYGPSLRQWLGNR
LSADAVSHAEVPAE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgataattctctccacaacgggggcctgcgcactgtcgtggtgccggccgca
ggtctgggaacccgcttcctgccggcgaccaagacggtccccaaagaactccttccggtc
gtcgatacacccggtatcgaactcattgccagggaggccgcccaggcgggcgcgtcccgc
atggcggtcgtgacggcaccccgtaagcaggggatcatggcctacttcgaccgggacgag
ctgctggagtcgacgctggagtcccgcggcaagaccgcgcagctggagaaggtccaggca
gtgaacaccctggtggacgccgtggcggtcaaccaggaccggccgctgggtctcggccat
gccgtgggctgcgccgagtccgccctcgacgatgacgaggactgcttcgctgtcctgctg
ccggacgacctcgtgctgccgttcggcgtcctcaacgagatgctggaggtgcgtcgccgg
ttcggcggtaccgtgctctgcggcttcgaggtccccgaggacgaggtctcgaactacggt
gtcttcgatctcgaggagaccgacgacagtgcaggttcccaggtccgcaaggtcagggga
atggtcgagaagccggatgcggaggacgccccctcaaccgtcgtcgccgccggccgctac
ctgctcgaccgcaccatcttcgacgccctgcgtcgcatcgagccgggcaagggcggcgag
ttgcagctcaccgacgccattgaactgctcatcgaagaaggtcatccggtccatgtcttc
atccaccagggtggacgccatgacctcggtaaccccggtggctacatccgggcctgtgtc
gacttcgccctcaacgacgacacctacggcccctccctgcgtcagtggctcggcaaccgc
ctctccgcggacgccgtgtcccatgccgaggtgcccgccgagtag

DBGET integrated database retrieval system