KEGG   Corynebacterium variabile: CVAR_2084Help
Entry
CVAR_2084         CDS       T01594                                 

Gene name
fadA4
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cva  Corynebacterium variabile
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CVAR_2084 (fadA4)
   00630 Glyoxylate and dicarboxylate metabolism
    CVAR_2084 (fadA4)
   00640 Propanoate metabolism
    CVAR_2084 (fadA4)
   00650 Butanoate metabolism
    CVAR_2084 (fadA4)
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_2084 (fadA4)
   00072 Synthesis and degradation of ketone bodies
    CVAR_2084 (fadA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVAR_2084 (fadA4)
   00310 Lysine degradation
    CVAR_2084 (fadA4)
   00380 Tryptophan metabolism
    CVAR_2084 (fadA4)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CVAR_2084 (fadA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVAR_2084 (fadA4)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CVAR_2084 (fadA4)
Enzymes [BR:cva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CVAR_2084 (fadA4)
Exosome [BR:cva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CVAR_2084 (fadA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2365666..2366874)
Genome map
AA seq 402 aa AA seqDB search
MSAASAQPAPTPEDIVIVGAARTAQGKMLGALASKTAVDLGATAISTALERAGVAAETVG
HVVMGQVVQAGAGQNPAKQAAVAAGVPVSTPADTVNKVCLSGLDAVIHGSRLLRLGDADV
VVAGGQESMTNAPHLAAGVRAGAKFGSLVLQDSLERDGLTDAVHGTAMGVETEEGNTTRG
ITRAEQDRVAARSHQRAEAAIAEGTFAEEIAPVEVKTRKGTVIVDTDEGVRPGTTEESLA
GLRPAFATDGTITAASASQISDGAAAVVLTTRAYAEANDLEVLAALAAYGQTAGPDTYLH
SQPAQAVAAALGKAGWEASDLDFLEINEAFAAVVVQSLRDLDYPLERTNIHGGGIALGHP
IGCSGARLVVAAAHELNRRGGGKAAVSLCGGGGQGDALILWR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcatccgcccagcccgcccccacccccgaggacatcgtcatcgtcggtgcc
gcgcgcaccgcccagggcaagatgctcggggccctggcctccaagaccgcggtggacctc
ggtgcaaccgccatcagtaccgcgcttgagcgcgccggtgtcgccgccgagactgtcggc
catgtggtcatggggcaggtcgtgcaggccggcgccggtcagaacccggccaagcaggcg
gcggtggctgccggtgtgccggtctccaccccggccgacaccgtgaacaaggtctgcctg
tcgggtctggacgcggtgatccacgggtcccgtctgctgcgtctcggggacgccgacgtg
gtggtcgccggtggtcaggagtcgatgaccaatgcgccgcatctggctgccggtgtgcgg
gccggggcgaagttcggttccctggtgctgcaggattctctggagcgtgacgggttgact
gatgcggtgcacggtacggcgatgggggtggagactgaggagggtaacaccacccggggt
atcacccgtgctgagcaggaccgggttgccgcgagatcgcatcagcgggccgaggctgcg
attgctgaggggactttcgccgaggagatcgccccggtggaggtcaagacccgcaagggt
accgtcatcgtcgacaccgacgagggtgtgcgacccgggacgaccgaggagtcgctggcg
ggtctgcgtccggcgttcgccaccgacgggacgatcaccgcggcgtcggcctcgcagatc
tccgacggtgccgcggcggtcgtgctgaccacccgcgcgtatgcggaggccaacgatctt
gaggtccttgctgccctggctgcctacggtcagaccgcgggtccggacacctacctgcac
tcccagccggcgcaggcggtcgccgccgcgctgggtaaggccggctgggaggcgtcggat
ctggacttcctggagatcaacgaggcgttcgctgcggtggtggtgcagtcgctgcgggat
ctggactacccgctggagcggaccaatattcacggtggtggtattgcgttgggtcatccg
atcggttgctcgggtgcgcgtctggtcgtcgctgcggctcatgagctgaatcgtcggggc
ggcggtaaggccgccgtgtcgctgtgcggtggtggcggccaaggtgacgccctgatcctc
tggcgctga

DBGET integrated database retrieval system