KEGG   Corynebacterium variabile: CVAR_2367Help
Entry
CVAR_2367         CDS       T01594                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cva  Corynebacterium variabile
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CVAR_2367
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CVAR_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2673645..2674832
Genome map
AA seq 395 aa AA seqDB search
MTGARQLSQALDGCNILLPVDRRSGEFSTALERHGAETTVAPSLTITSHFDDAELLDATH
RIIADPPDIVIVTTGVGFRGWMDATEQDGSQEELLAALEAAQILVRGPKARGAVQGVGLD
IDWVAETETSAEITEFLLAEGVRDAKVVIQHHGEGDPLMEQILQDAGAEVRGLVIYRWGP
PPDPDLVARTTGMVAGGAVDAVLFTSAPGARAWLKTAERIGTLPAIRQLAGERTMFGAVG
PITAAPLRTRGFEVVVPERYRLGALVRETVNQLAGPDTATATSFGPLHIRTGGALLDGTF
HALGRTGSDVLRILAARPGRVLSRSEIAEELSSGVVGGRPEGWADGQTTERAVEVAVARV
RSALETPDLIQTVYKRGYRLALDDADLAALHSRGA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgcgcgtcagctttcccaggccctcgacggctgcaatatcctgctcccggtg
gaccgccgctcgggcgagttctccaccgccctggagcgtcacggcgcggagaccaccgtc
gccccgtcgctgaccatcacctcgcatttcgacgacgccgagctgctggacgccacccac
cggatcatcgccgacccgccggacatcgtcatcgtcaccacgggtgtggggttccggggc
tggatggacgccaccgagcaggacggctcccaggaggagctcctcgccgcactggaggcc
gcccagatcctggtgcgtggcccgaaggcccgcggcgcggtccagggtgtcggcctggac
atcgactgggtcgcggagaccgagacctccgccgagatcacggagttcctgctggccgag
ggcgtgcgggacgccaaggtcgtcatccagcaccacggcgagggtgatccgttgatggag
cagatcctgcaggacgccggtgccgaggtccgtggtctggtgatctaccgctggggtcca
ccgccggaccccgatctcgtcgcacgaacgaccggcatggtcgccggtggcgcagtggac
gccgtgctgttcacctctgcaccgggggcccgcgcctggctgaagaccgcggagcggatc
gggacgctgccggcgatccgtcagctcgccggtgagcggaccatgttcggcgcggtgggt
ccgatcaccgccgctcccctgcggacccgcggcttcgaggtggtcgtcccggagcgctac
cggctgggtgcactggtccgtgagacggtgaaccagctggccggcccggacacggcgacg
gccacgtccttcggcccgctgcacatccgcaccggtggtgcgcttctcgacggcaccttc
cacgcgttgggacgcacggggtcggacgtcctgaggatcctggccgcccggccgggacgg
gtgctgtcccggtcagagatcgccgaggaactgtcctccggtgtggtcggtggccgaccg
gagggttgggccgacgggcagaccacggaacgcgccgtggaggtcgcggtcgcccgggtg
cgcagtgcgctggagaccccggacctgatccagacggtctacaagcgtggctaccgcctg
gccctggatgacgccgaccttgccgccctgcactcccgtggggcatga

DBGET integrated database retrieval system