KEGG   Corynebacterium variabile: CVAR_2451Help
Entry
CVAR_2451         CDS       T01594                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cva  Corynebacterium variabile
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CVAR_2451
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CVAR_2451
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CVAR_2451
Enzymes [BR:cva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CVAR_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2761466..2763154
Genome map
AA seq 562 aa AA seqDB search
MTRFSRRGFLAGAAALGALAMAPRAAAGESRESGVFAHSVASGDPLPDALVLWTRVTPVP
DATPGSGRGEPTTVRWEIARSETFSGALSGDVRTDASADHTVKVDATGLAPATDYVFRFT
VLDGPAAGSVSRTGHARTAPAPGADPGSLRFGVCSCANYEAGYFRAYRDMADRSDLEFTL
HLGDFTYECATGEYGGAYDTTVRRVQPANRTVTLADYRIRQGFYHQDADLADLLAARPLI
TIWDDHEFSDNSWRDGVTGNSVEPGDDVAAMKAAATQAYLEWMPVRGLPLQRHLRFGTLA
EFIIPDLRSFRDEQQEIPAAWQAGSGAGATDRTMMGHSQADWFTDVLTSSDTRWQLIGNE
VMLAPMTLPNTLDPRIHDWLVDQVGLPSDGLALNADQWDGYMAERQRIIDVIGGKAGNSG
DAKPGVVFLTGDIHSSWAADIPAHAGDWRLGRNRQAVATEFVVPSVTAASAYDGMASSPA
LKEPVLAALGAGESIIGQVDDWFRYVDLTQHGYMAVDVNADRVQADWHHGDVLTKDASLT
WSTGFMAVHGSPGAVPAPGQLR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcggttcagccgtcgtggcttcctcgccggtgccgcggcgctcggtgcgctggcg
atggccccgcgggcagcggccggggagtccagggagtccggggtcttcgcccactcggtg
gcctccggcgatcccctgccggatgcgctggtcctgtggacgcgcgtcactccagtcccg
gacgccacgcccgggtcaggacgcggcgagccgaccaccgtccgctgggagatcgccagg
tcagagaccttctccggagcgctctccggggacgtgcgcaccgacgcgtccgccgaccac
acggtgaaggtggacgccacgggcctggccccggccaccgactacgtcttccggttcacc
gtgctcgacggcccggctgccggatcggtctcgcgcaccggtcacgcccgcaccgctccg
gcgccgggtgcggatccggggagtctgcgcttcggcgtgtgctcctgcgcgaactacgag
gccgggtacttccgcgcctaccgggacatggccgaccgctctgacctggagttcacgctg
catctgggtgacttcacctacgagtgcgccacgggtgagtacggcggggcgtacgacacg
accgtgcgtcgggtgcagccggcgaaccggaccgtcacgctggcggactaccggatccgg
caggggttctaccatcaggacgccgacctggccgatctgctggcggcccgaccactcatc
accatctgggacgaccacgagttctccgacaactcctggcgcgacggggtcaccggcaac
tccgtcgagccgggcgacgacgtcgccgccatgaaggccgcggcgacgcaggcctacctc
gagtggatgccggtgcgtggcctgccgttgcagcgtcatctgcggttcgggacgctcgcc
gagttcatcatccctgacctgcggtccttccgtgatgagcagcaggagatcccggcggcg
tggcaggccggcagcggcgccggtgccaccgaccggacgatgatgggacacagccaggcc
gactggttcaccgacgtactgaccagttcggacacgcgctggcagctcatcggcaacgag
gtgatgctcgctccgatgacgctgccgaacaccctcgacccgcggatccacgactggttg
gtcgaccaggtcggcctgccgtccgacgggctcgcgctcaacgccgaccagtgggacggg
tacatggcggagcggcagcggatcatcgacgtcatcggaggtaaagcaggtaactccggg
gacgcgaagccgggcgtcgtcttcctcaccggggacatccactcgtcctgggccgcggac
attccggcacatgccggtgactggcgactcggccgcaaccgtcaggcggtggccacggag
ttcgttgtcccctcggtgacggcggcgagtgcctacgacggcatggcgtcctcccctgcg
ctgaaggaaccggtcctcgcggcacttggcgccggcgaaagcatcatcgggcaggtcgac
gactggttccgctacgtcgatcttacgcagcacggctacatggccgtggacgtgaacgcc
gaccgtgtccaggcggactggcaccacggcgatgttctcacgaaggacgcctcgctgacc
tggtcgaccggattcatggccgtccacgggtcgccgggtgcggtgccggcgccggggcag
ttgaggtag

DBGET integrated database retrieval system