KEGG   Corynebacterium variabile: CVAR_2735Help
Entry
CVAR_2735         CDS       T01594                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cva  Corynebacterium variabile
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cva00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3072887..3073924)
Genome map
AA seq 345 aa AA seqDB search
MSEPTLPNLPTDTYGVPAPSRRPRRLRTSATMRNFVAETQLDPAQFVLPVFIAEGIDAPR
EISAMPGVYQHTETSLLKAAEEAVKAGVGSIDVFGVPTPEHKDFAGTQAWAADGILNKGV
AALRREFGDDLLVMSDTCLDEFTDHGHCGVLTTDHYGNTVVDNDATLPLYAAMAVSQARA
GAHIVSPSGMMDGQIRVIRAALDAEGFQDVSILAYSAKYAGAFYGPFREAVGSTLQGDRK
TYQQDPRNAREAIMEVQLDIDEGADMVMVKPALPYLDILSQVADYSTVPVAAYQVSGEYS
MITAAAQNGWLDREKTIMDSLTSIRRAGADIILTYWATEAAQMLA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcccaccctcccgaacctccccaccgacacctacggcgtccccgccccgtcg
cgtcgcccgcgccggctgcgcaccagtgcgacgatgcgcaacttcgtcgctgagacgcag
cttgatccggcgcagttcgtcctcccggtgttcatcgccgaggggatcgacgccccgcgt
gagatctccgcgatgcccggtgtgtaccagcatactgagacctccctgctcaaggcggcg
gaggaggcggtgaaggcgggcgtcggttcgatcgacgtcttcggcgtccccaccccggag
cacaaggacttcgccggcacccaggcctgggccgccgacggcatcctcaacaagggtgtc
gccgccctgcgccgtgagttcggtgacgatctgctggtcatgtcggacacctgcctcgac
gagttcaccgaccacggtcactgcggtgtgctgaccaccgaccactacggcaataccgtc
gtcgacaatgacgccaccctcccgctgtacgcggcgatggctgtcagccaggcccgcgcc
ggcgcccacatcgtcagtccctcgggcatgatggacggccagatccgcgtcatccgtgcc
gcgctggacgccgagggcttccaggacgtctctatcctggcctactccgcgaagtacgcc
ggtgccttctacggcccgttccgtgaggctgtcggttcgacgctgcagggtgaccggaag
acctaccagcaggatccgcgcaacgcccgtgaggcgatcatggaggtccagctcgacatc
gacgagggtgcggacatggtcatggtcaagccggccctgccgtacctcgacatcctcagc
caggtcgcggactactcgactgtccccgtcgccgcctaccaggtctccggtgagtattcg
atgatcaccgcggcggcgcagaacggctggctcgaccgtgagaagacgatcatggattcg
ttgacctcgatccgtcgtgccggtgcggacatcatcctcacctactgggccaccgaggcc
gcgcagatgctggcctga

DBGET integrated database retrieval system