KEGG   Corynebacterium variabile: CVAR_2749Help
Entry
CVAR_2749         CDS       T01594                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cva  Corynebacterium variabile
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_2749 (gpmA)
   01230 Biosynthesis of amino acids
    CVAR_2749 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_2749 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CVAR_2749 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVAR_2749 (gpmA)
Enzymes [BR:cva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CVAR_2749 (gpmA)
Exosome [BR:cva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CVAR_2749 (gpmA)
  Exosomal proteins of melanoma cells
   CVAR_2749 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3088868..3089689)
Genome map
AA seq 273 aa AA seqDB search
MKTGESRSSPLYPHHTRGTMKAMSNDNKGTLILLRHGQSQWNASNQFTGWVDVDLTDQGR
AEGANAGKLIADAGLEPGILYTSLLRRAITTAHLALDAADRLWIPVIRDWRLNERHYGAL
QGLDKAETKEKYGNDQFMAWRRSYDTPPPELEDDSEYSQAGDPRYAGIENPPRTECLLDV
VKRFVPYFTVEILPRLESGETVMVAAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYR
FAADGSVTNPGGEYLDPAAAEAGAAAVAAQGGK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgggtgaatcccggtcctcgccgctgtacccccaccacacccgtggcacaatg
aaggccatgagcaacgacaacaagggcactctgatcctgctccgtcacgggcagagccag
tggaacgcctccaaccagttcaccggatgggtcgacgtcgacctcaccgaccagggtcgc
gccgagggtgccaacgccggcaagctcatcgccgacgccggcctcgagcccggcatcctg
tacacctcgctgctgcgtcgtgcgatcaccaccgcccacctcgccctggatgccgccgac
cgcctctggatccccgtgatccgcgactggcgactcaacgagcgtcactacggtgcgctg
cagggtctcgacaaggccgaaaccaaggagaagtacggcaacgaccagttcatggcatgg
cgtcgcagctacgacaccccgccgcccgagctggaggacgattccgagtactcccaggcc
ggcgacccgcgctacgccggtatcgagaacccgccgcgcaccgagtgcctgctcgacgtc
gtcaagcgcttcgtcccctacttcaccgtcgagatcctcccgcgcctcgagtccggcgag
accgtcatggtcgccgcccacggcaactcgctgcgcgccctggtcaagcacctcgacaac
atctccgacgaggacatcgccggcctgaacatcccgaccggcattccgctggtctaccgg
ttcgccgccgacggctccgtcaccaaccccggtggcgagtacctcgacccggcggccgct
gaagccggtgccgccgccgtcgccgcacagggcggcaagtag

DBGET integrated database retrieval system