KEGG   Corynebacterium variabile: CVAR_2766Help
Entry
CVAR_2766         CDS       T01594                                 

Gene name
aceB
Definition
Malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cva  Corynebacterium variabile
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_2766 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CVAR_2766 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    CVAR_2766 (aceB)
Enzymes [BR:cva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CVAR_2766 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3106798..3109002)
Genome map
AA seq 734 aa AA seqDB search
MTQQTQRITAGGLEVAKTLYDFVNGEVLPGTGVDQEKFWEGFGAIVAKHTPRNRELLAKR
VDLQAKLDEWYTQNPGTQDAEKYTAFLKEIGYLVDQPEDFEIRTENVDAEFATTAGPQLV
VPILNARFAINAANARWGSLYDALYGTDVISEENGAEKGKGYNKVRGDKVIAWGRDFLDE
AVPLESGSHADVEKYDITSGQLAAVIDGNEVHLQQPEVFVGYAGEKDAPTDIVLKHNGLH
IDIQIDAESPIGSTDKAGVKDIVLEAAVTAIMDFEDSIAAVDATDKVLGYHNWLGLNQGT
LAEEVSKGGKTFTREQNDDRYFTARDGSELRLHGRSTMLCRNVGHLMTNPAILDAEGNEV
FEGIMDAVITAACAIPGTDLDNARRNSREGSIYIVKPKQHGPEESAFTNDLFADVEDLLN
LPRFTLKVGLMDEERRTSVNLDACIEAIADRVAFINTGFMDRTGDEIHTSLLAGPMFRKP
KLKASLFMESYENNNVDAGLAHGLSGKAQIGKGMWAKTDLLAEMVEQKIGQLRQGASTAW
VPSPTGATLHATHYHVVDVYAVQEKLITDGRRDSIPGILTVPVAAAKVGEGDATWTAEEI
QEELDDNCQSILGYVVRWVEQGVGCSKVPDIHDIDLMEDRATCRINSQLLANWLKHGVVT
EEQVIEALQRMAAVVDRQNAGDDTYRDMAPDFENSVAWKAARDLVLLGTTQPSGYTEPIL
HARRLEFKELHGIA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcagacgcagcgcatcaccgccggtggcctcgaggtcgccaagaccctctac
gatttcgtcaacggcgaggtcctgccgggcaccggggtggaccaggagaagttctgggag
ggcttcggcgccatcgtcgccaagcacaccccgcgcaaccgtgagctgctcgccaagcgg
gttgacctgcaggcgaagctggacgagtggtacacgcagaacccgggcacgcaggacgcc
gagaagtacaccgccttcctcaaggagatcggctacctcgtcgaccagccggaggacttc
gagatccgcaccgagaacgtggacgccgagttcgccaccaccgccggcccgcagctggtc
gtgccgatcctcaacgcccgcttcgcgatcaacgccgcgaacgcccgctggggttccctc
tacgacgccctgtacggcaccgacgtcatctccgaggagaacggcgccgagaagggcaag
ggctacaacaaggtccgcggcgacaaggtcatcgcctggggccgtgacttccttgacgag
gctgtgccgctggagtccggctcccacgccgacgtcgagaagtacgacatcacctccggc
cagctcgccgccgtcatcgacggcaacgaggtccacctgcagcagcccgaggtcttcgtc
ggctacgccggtgagaaggacgccccgaccgacatcgtgctcaagcacaacggtctgcac
atcgacatccagatcgacgcggagtccccgatcggcagcaccgacaaggccggtgtcaag
gacatcgtcctggaggccgccgtgaccgccatcatggacttcgaggattccatcgccgcg
gtggacgccaccgacaaggtcctcggctaccacaactggctcggcctgaaccagggcacg
ctggccgaggaggtctccaagggcggaaagaccttcacccgtgagcagaacgacgaccgc
tacttcaccgcacgtgacggctccgagctccgcctgcacggccgctccaccatgctgtgc
cgcaacgtcggtcacctgatgaccaaccccgccatcctcgacgccgagggcaacgaggtc
ttcgagggcatcatggacgccgtcatcaccgccgcctgcgccatccccggcacggacctg
gacaacgcccgccgcaactcccgcgagggctcgatctacatcgtcaagccgaagcagcac
ggtccggaggagtccgccttcaccaatgacctgttcgccgacgtcgaggacctcctcaac
ctcccgcgcttcacactcaaggtcggcctgatggacgaagagcgccgcacctccgtcaac
ctggacgcctgcatcgaggccatcgccgaccgcgtggccttcatcaacaccggcttcatg
gaccgtaccggcgacgagatccacacctcgctgctggccggcccgatgttccgtaagccg
aaactcaaggcctccctgttcatggagtcctacgagaacaacaacgtcgacgccggcctg
gcccacggtctctcgggcaaggcccagatcggtaagggcatgtgggccaagaccgacctt
ctcgccgagatggtggagcagaagatcggccagctgcgtcagggcgcctccaccgcgtgg
gtcccgtccccgaccggtgcgaccctgcacgccacccattaccacgtggtcgacgtctac
gccgtccaggagaagctgatcaccgacggtcgccgcgactccatcccgggtatcctcacc
gtcccggtcgccgccgccaaggtcggcgagggcgacgccacctggaccgccgaggagatc
caggaggagctggacgacaactgccagtccatcctgggctacgtggtccgctgggtcgag
cagggtgtcggttgctccaaggtgccggacatccacgacatcgacctcatggaggaccgg
gccacctgccgcatcaactcccagctgctggccaactggctcaagcacggtgtcgtcacc
gaggagcaggtcatcgaggccctgcagcgcatggccgccgtggtcgaccgtcagaacgcc
ggcgacgacacctaccgcgacatggcccccgacttcgagaactcggtcgcctggaaggcc
gcccgtgacctcgtcctgctcggtaccacccagccctccggctacaccgagccgatcctc
cacgcccgccgcctggagttcaaggagctgcacggtatcgcctaa

DBGET integrated database retrieval system