KEGG   Corynebacterium variabile: CVAR_2767Help
Entry
CVAR_2767         CDS       T01594                                 

Gene name
aceA
Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cva  Corynebacterium variabile
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CVAR_2767 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CVAR_2767 (aceA)
Enzymes [BR:cva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CVAR_2767 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3109438..3110727
Genome map
AA seq 429 aa AA seqDB search
MSNVGQPRTAAEIQKDWDENPRWANVTRDYTAEQVAELQGNVVEEHTLATRGAEILWDAV
NEPGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVQRINNALSRADEIARVEGDTSVDNWLVPIVADGEAGFGGALNVYELQKAMINAGASG
THWEDQLASEKKCGHLGGKVLIPTKQHVRTLNSARLAADVANTPTVVIARTDAEAATLLT
SDVDERDHEFLTGERSAEGYYYVKNGIEPCISRAKSFAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFKWSAHLDDDEIAKFQNELGAMGFKFQFITLAGFHALNYSM
FDLAHGYARNQMSAFVDLQNREFEAESRGFTAVKHQREVGAGYFDRIATTVDPNSSTTAL
KGSTEEAQF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgtcggacagccgcgtaccgccgccgaaatccagaaggactgggacgagaac
ccccgttgggccaacgtcacccgcgactacaccgccgagcaggttgccgagctccagggc
aacgtcgtcgaggagcacaccctcgccacccgcggtgccgagatcctctgggacgccgtg
aacgagccgggcgacggctacatcaacgccctcggtgccctgaccggtaaccaggccgtc
cagcaggtccgcgccggcctgaaggccgtctacctctccggttggcaggtcgccggtgac
gccaacctctccggccacacctacccggaccagtccctgtacccggcgaactccgttccg
tccgtggtccagcgcatcaacaacgccctctcccgcgccgacgagatcgcccgcgtcgag
ggtgacacctccgtcgacaactggctcgtcccgatcgtcgccgacggtgaggccggcttc
ggtggcgccctgaacgtctacgagctgcagaaggccatgatcaacgccggtgcctccggc
acccactgggaggaccagctggcctccgagaagaagtgcggccacctgggcggcaaggtc
ctcatcccgaccaagcagcacgtccgtaccctgaactccgcccgtctggccgccgacgtc
gccaacaccccgaccgtcgtcatcgcccgcaccgacgccgaggccgctaccctgctgacc
tccgacgtcgacgagcgcgaccacgagttcctcaccggtgagcgttccgccgagggctac
tactacgtcaagaacggcatcgagccctgcatctcccgtgcgaagtccttcgctccgtac
gccgacatgatctggatggagaccggtaccccggatctcgagctcgccaagaagttcgcc
gagggcgtccgctccgaattcccggaccagctcctgtcctacaactgctccccgtccttc
aagtggtccgcccacctggacgacgacgagatcgccaagttccagaacgagctgggcgcc
atgggcttcaagttccagttcatcaccctggccggcttccacgccctcaactactccatg
ttcgatctggcccacggctacgcccgcaaccagatgtccgccttcgtggacctgcagaac
cgcgagttcgaggccgagtcccgcggcttcaccgctgtcaagcaccagcgcgaggtcggc
gccggttacttcgaccgcatcgccaccaccgtggacccgaactcctccaccaccgccctc
aagggctccaccgaggaggcccagttctag

DBGET integrated database retrieval system