KEGG   Corynebacterium variabile: CVAR_3049Help
Entry
CVAR_3049         CDS       T01594                                 

Gene name
echA3
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cva  Corynebacterium variabile
Pathway
cva00071  Fatty acid degradation
cva00280  Valine, leucine and isoleucine degradation
cva00281  Geraniol degradation
cva00310  Lysine degradation
cva00360  Phenylalanine metabolism
cva00362  Benzoate degradation
cva00380  Tryptophan metabolism
cva00410  beta-Alanine metabolism
cva00627  Aminobenzoate degradation
cva00640  Propanoate metabolism
cva00650  Butanoate metabolism
cva00903  Limonene and pinene degradation
cva00930  Caprolactam degradation
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CVAR_3049 (echA3)
   00650 Butanoate metabolism
    CVAR_3049 (echA3)
  Lipid metabolism
   00071 Fatty acid degradation
    CVAR_3049 (echA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVAR_3049 (echA3)
   00310 Lysine degradation
    CVAR_3049 (echA3)
   00360 Phenylalanine metabolism
    CVAR_3049 (echA3)
   00380 Tryptophan metabolism
    CVAR_3049 (echA3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVAR_3049 (echA3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CVAR_3049 (echA3)
   00281 Geraniol degradation
    CVAR_3049 (echA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVAR_3049 (echA3)
   00627 Aminobenzoate degradation
    CVAR_3049 (echA3)
   00930 Caprolactam degradation
    CVAR_3049 (echA3)
Enzymes [BR:cva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CVAR_3049 (echA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEK35944
UniProt: G0HCY0
Position
689043..689882
Genome map
AA seq 279 aa AA seqDB search
MYISPTRGVDDRGTMATMTDSQPTYETILTSVADGVATITLNRPKALNALNQTVMEEVVG
ALEIFDADQSVGAVVITGSEKAFAAGADITQMKDQTWPDIKLKRFYAQWERVANIQTPVI
TAVQGFALGGGCELAMMGDIILASEKAKFGQPEITLGVIPGMGGTQRLTRAVGKYKAMDL
ILTGRMMGAEEAERAGLVSRILPVEGFTDAVDAVARKVASFSRVALAAATETVDAALNTP
LTEGMRQEREAFWGLFATEDQKEGMAAFVEKRDPEWKHR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgtacatcagtccgacccggggtgtcgacgaccgtggcacaatggccaccatgacagac
tcgcaacccacgtacgagacgatcctcacctccgtcgccgacggcgtcgccacgatcacg
ctgaaccggccgaaggcgctcaacgcactcaaccagaccgtcatggaggaggtcgtcggc
gccctggagatcttcgacgccgaccagtccgtcggagccgtcgtcatcaccggcagcgag
aaggccttcgctgccggtgccgacatcacccagatgaaggaccagacctggccggacatc
aagctcaagcgcttctacgcgcagtgggaacgggtcgcgaacatccagacccccgtcatt
accgcggtccagggattcgctctcggcggcggctgtgaactcgccatgatgggcgacatc
atcctcgccagtgagaaagcgaagttcggtcagcccgagatcaccctcggcgtcatcccc
ggtatgggtggtacccagcgcctcacccgcgccgtcggcaagtacaaggccatggacctc
atcctcaccggacgcatgatgggcgccgaggaagcagagcgggccggcctggtctcgcgc
atcctgccggtcgagggcttcaccgacgcggtggacgccgtcgcgcggaaggtggcgtcc
ttctcccgcgtggcactggccgccgcgaccgagacggtggacgctgcgctcaacaccccc
ctgaccgaagggatgcgccaggagcgcgaggcgttctggggactgttcgccaccgaggac
cagaaagaggggatggcggccttcgtcgagaagcgcgatcccgagtggaagcaccgctag

DBGET integrated database retrieval system