KEGG   Chromobacterium vaccinii: BKX93_21165Help
Entry
BKX93_21165       CDS       T04565                                 

Definition
(GenBank) 2,4-diacetylphloroglucinol biosynthesis protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00071  Fatty acid degradation
cvc00072  Synthesis and degradation of ketone bodies
cvc00280  Valine, leucine and isoleucine degradation
cvc00310  Lysine degradation
cvc00362  Benzoate degradation
cvc00380  Tryptophan metabolism
cvc00620  Pyruvate metabolism
cvc00630  Glyoxylate and dicarboxylate metabolism
cvc00640  Propanoate metabolism
cvc00650  Butanoate metabolism
cvc00900  Terpenoid backbone biosynthesis
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01200  Carbon metabolism
cvc01212  Fatty acid metabolism
cvc02020  Two-component system
Module
cvc_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:cvc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKX93_21165
   00630 Glyoxylate and dicarboxylate metabolism
    BKX93_21165
   00640 Propanoate metabolism
    BKX93_21165
   00650 Butanoate metabolism
    BKX93_21165
  Lipid metabolism
   00071 Fatty acid degradation
    BKX93_21165
   00072 Synthesis and degradation of ketone bodies
    BKX93_21165
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKX93_21165
   00310 Lysine degradation
    BKX93_21165
   00380 Tryptophan metabolism
    BKX93_21165
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKX93_21165
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKX93_21165
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BKX93_21165
Enzymes [BR:cvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKX93_21165
Exosome [BR:cvc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKX93_21165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt Thiolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOZ52263
UniProt: A0A1D9LM53
Position
complement(4576224..4577420)
Genome map
AA seq 398 aa AA seqDB search
MSARRVAIVAAAYTPKPGSSRVRQTFKEMIVESSYQALANAGMDAREIQGVAYGYHGEGI
SEYGGLGPTISDTLGVSPAPTFITSSNCTSSSVSFQMGHQMVASGEYDIVLCGGFEKMTD
HFNYAEYIGSSTECEYDYFLGISHTDAFALATSEYFHRYGYAGREADVLAAFGRQMRVYA
HNTPTATRYGQPIPSLDELKKSEAHGSMLAWGEASGCAILVAEHLAHKYTDKPVFIKGCA
YTGVSHYFGTRYHNPTLRHPGLATDTGMALSANSVACAEIAYKKAGISAKDIDVAQVYDL
LGAGLIQMESMGICKPGQAGHFVLEGGIAIDGETPLNTDGGNIGRGHASGCDGILHITEL
FRQLRGESDNQVKNARIAVSQNLGGYAAHNSVIVLGNE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgacgcgtcgccatcgtggccgcggcctacacgcccaagccgggcagcagc
cgggtccgccagactttcaaggaaatgatcgtcgagtcgtcctaccaggccttggccaac
gccggcatggacgcccgcgaaatccagggcgtggcctatggctaccacggcgagggcatc
tcggaatacggcggcctgggcccgaccatttccgacacgctgggcgtcagccccgccccc
accttcatcaccagctcgaactgcaccagcagctcggtatcgttccagatgggccaccag
atggtcgcgtccggcgagtacgacatcgtgttgtgcggcggcttcgagaagatgaccgac
catttcaactacgccgaatacatcggctccagcaccgagtgcgagtacgactacttcctg
ggcatctcgcacaccgacgccttcgcgctggccacctcggaatacttccaccgctacggc
tacgccggccgcgaagccgacgtgctggccgccttcggccgccagatgcgcgtctacgcc
cacaacacgccgaccgccacccgctacggccagcccatcccctcgctggacgagctgaag
aaaagcgaggcgcacggctcgatgctggcctggggcgaggccagcggctgcgcgatcctg
gtggccgagcacctggcgcacaagtacaccgacaagccggtgttcatcaaaggctgcgcc
tacaccggcgtgtcgcattacttcggcacccgctaccacaatccgacgctgcgccacccg
ggcctggccaccgacaccggcatggcgctgtccgccaactcggtcgcctgcgccgagatc
gcctacaagaaggccggcatcagcgccaaggacatcgacgtggcccaggtctacgacctc
ttgggcgccggcctgatccagatggaatcgatgggcatctgcaagcccggccaggccggc
cacttcgtgctggaaggtggcatcgccatcgacggcgaaacgccgctgaacaccgacggc
ggcaacatcggccgcggccacgcctccggctgcgacggcatcctgcacatcaccgagctg
ttccgccagctgcgcggcgaatccgacaaccaggtgaagaacgcgcgcatcgcggtctcg
caaaacctcggcggctacgccgcccacaactcggtcatcgtactgggcaacgaataa

DBGET integrated database retrieval system